KEGG   Micromonospora sp. L5: ML5_3880Help
Entry
ML5_3880          CDS       T01379                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mil  Micromonospora sp. L5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ML5_3880
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML5_3880
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ML5_3880
Enzymes [BR:mil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ML5_3880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
4082646..4083872
Genome map
AA seq 408 aa AA seqDB search
MSAAPATGQVPDAAGHFGRFGGRFVPEALVAALDELDAAYRKAMGDEDFLAEFDALLRDY
AGTPSMLYEARRFSAQIGARVLLKREDLNHTGAHKVRNVLGQALLTKRMGKRRVIAETGA
GQHGVATATAAALFDLECVVYMGQVDTERQALNVARMRMLGATVVPVTTGSRTLKDAMNE
AMRDWVANVDSTHYLIGTAAGPHPFPEMVRDFVRGIGEEARRQCLDLTGALPDAVAACVG
GGSNALGIFHAFVPDAGVRLYGFEAGGEGVDTGRHAASITGGSSGVLHGTRTYVLQDADG
QTIESHSISAGLDYPGVGPEHAWLHDTGRATYLPVDDADAMAAFELLCRTEGVIPAIESA
HALAGARAIAPRLAEELGREPVIVVNLSGRGDKDVHTAGAYFGILDKE
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcacccgcaaccggccaggtccccgacgccgccggtcacttcggccggttc
ggcggccggttcgtccccgaggcgctcgtcgccgcgctcgacgagctggacgcggcgtac
cggaaggcgatgggcgacgaggacttcctcgccgagttcgacgcgctgctgcgcgactac
gccggcacgccctcgatgctctacgaggcccggcggttctccgcgcagatcggcgcgcgg
gtcctgctcaagcgggaggacctcaaccacaccggcgcgcacaaggtccgtaacgtgctg
ggccaggcgctgctcaccaagcggatgggcaagcggcgggtcatcgcggagaccggcgcc
ggccagcacggcgtcgccaccgccaccgccgccgcgctgttcgacctggaatgcgtcgtc
tacatgggccaggtggacaccgagcggcaggcgctgaacgtggcgcggatgcggatgctc
ggcgccaccgtcgtcccggtgaccaccggctcgcgcacgctcaaggacgcgatgaacgag
gcgatgcgggactgggtcgccaacgtcgacagcacccactacctgatcggcaccgccgcc
gggccgcacccgttcccggagatggtccgcgacttcgtgcgcggcatcggcgaggaggcg
cgccggcagtgcctggacctgaccggcgcgctgccggacgcggtggcggcctgcgtcggc
ggcggctccaacgcgctgggcatcttccacgcgttcgtgccggacgccggggtccggctc
tacggcttcgaggccggcggcgagggcgtcgacaccggccggcacgccgccagcatcacc
ggcggctcgtccggcgtgctgcacggcacccgcacgtacgtcctccaggacgccgacggc
cagaccatcgagtcgcactcgatctcggccggcctggactacccgggcgtcgggccggag
cacgcctggctgcacgacaccggccgggccacctacctgccggtcgacgacgccgacgcg
atggccgcgttcgagctgctctgccgcaccgagggcgtgatcccggcgatcgagagcgcg
cacgcgctcgccggcgcccgcgcgatcgccccccggctcgccgaggagctgggccgggag
ccggtgatcgtggtcaacctgtccgggcggggcgacaaggacgtgcacaccgccggcgcg
tacttcggcatcctcgacaaggagtga

DBGET integrated database retrieval system