KEGG   Micromonospora sp. L5: ML5_3881Help
Entry
ML5_3881          CDS       T01379                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mil  Micromonospora sp. L5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ML5_3881
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML5_3881
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ML5_3881
Enzymes [BR:mil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ML5_3881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
4083877..4084680
Genome map
AA seq 267 aa AA seqDB search
MSRIGVAFDKARADGRAVLVGCMPAGFPTVEGSIAAMKAMVEAGVDVIEVEIPYSDPVMD
GPVIQKASDIALAGGVRVADALRVVEAVAATGASVVTMTYWNPIEQYGVDAFARDMAAAG
GTGLITPDLIPDEAAEWLAASDAHGLDRTFLVSPSSTDARLRMTVEHCRGFVYATAIMGV
TGARAQTSEAAPILVSRLREVTDIPVGVGLGVGTGAQAATVAGYADAVIVGSALVRCVLD
APDQAAGLTALRKLSAELAEGVRNPAR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcatcggggtcgccttcgacaaggcgcgggcggacgggcgggcggtgctggtc
ggctgcatgccggcgggcttcccgaccgtcgagggcagcatcgccgccatgaaggccatg
gtcgaggcgggcgtggacgtcatcgaggtggagatcccgtactccgacccggtgatggac
ggcccggtcatccagaaggcgagcgacatcgcgctcgccggcggtgtccgcgtcgccgac
gcgctgcgcgtcgtcgaggcggtcgcggcgaccggggcgagcgtggtcaccatgacctac
tggaacccgatcgagcagtacggcgtggacgcgttcgcccgcgacatggccgccgccggt
ggcaccggcctgatcacgccggacctgatcccggacgaggccgccgagtggctggccgcc
tccgacgcgcacggcctggaccgcacgttcctggtctcgccgtcctcgaccgacgcgcgg
ctgcggatgacagtcgagcactgccgcggcttcgtctacgccaccgcgatcatgggcgtc
accggcgcccgcgcgcagacctccgaggcggcgccgatcctggtctcccggctgcgcgag
gtcaccgacatcccggtcggcgtcgggctgggcgtcggcaccggcgcgcaggccgccaca
gtggccgggtacgccgacgcggtgatcgtgggcagcgcgctggtccgctgcgtgctggac
gctccggaccaggctgcaggcctgaccgcgctgcgcaagctcagcgccgaactcgccgag
ggcgtccgcaaccccgctcgctga

DBGET integrated database retrieval system