KEGG   Micromonospora sp. L5: ML5_3968Help
Entry
ML5_3968          CDS       T01379                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mil  Micromonospora sp. L5
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ML5_3968
   01230 Biosynthesis of amino acids
    ML5_3968
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ML5_3968
   00051 Fructose and mannose metabolism
    ML5_3968
   00562 Inositol phosphate metabolism
    ML5_3968
Enzymes [BR:mil01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ML5_3968
Exosome [BR:mil04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ML5_3968
  Exosomal proteins of bladder cancer cells
   ML5_3968
  Exosomal proteins of melanoma cells
   ML5_3968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
4188152..4188943
Genome map
AA seq 263 aa AA seqDB search
MASTTRRPLMAGNWKMNLNHLEANLLVQKLAASLNEKQLTDVECVVLPPFTDLRTVQTAV
DGDKLLIGYGAQDLSPHPSGAYTGDIAGPMLAKLGCGYVVVGHSERRQYHNEDDALVNAK
VSAALANGLTPILCIGEGLEVREQSGQVRHCCDQLDGALKGLTAEQVTKVVVAYEPVWAI
GTGKTATPDDAQEVCGAVRKRIAETYDEGTAEQVRILYGGSVKASNVAAIMAQPDVDGAL
VGGASLDAEEFAQICRFPEHITR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcacgacccgccggccgctgatggccggcaactggaagatgaacctgaaccac
ctcgaggccaacctgctggtgcagaagctggccgcgagcctgaacgagaagcagctcacc
gacgtcgagtgcgtggtgctgccgcccttcaccgacctgcgtaccgtgcagaccgccgtg
gacggcgacaagctgctgatcggctacggcgcgcaggacctgtcgccgcacccgtccggc
gcgtacaccggtgacatcgccgggccgatgctcgccaagctgggctgcggctacgtggtg
gtcgggcactccgagcggcggcagtaccacaacgaggacgacgcgctcgtcaacgcgaag
gtgtcggcggcgctggcgaacgggctcaccccgatcctctgcatcggtgagggcctggag
gtccgggagcagtcgggtcaggtgcggcactgctgcgaccagctcgacggcgcgctgaag
gggctcaccgccgagcaggtcaccaaggtcgtcgtggcgtacgagccggtctgggcgatc
ggcaccggcaagacggcgaccccggacgacgcccaggaggtctgcggcgcggtgcgcaag
cgcatcgccgagacctacgacgagggcaccgccgagcaggtccggatcctgtacggcggg
tcggtcaaggcgtcgaacgtcgccgcgatcatggcgcagccggacgtggacggggctctg
gtcgggggcgccagcctggacgcggaggagttcgcgcagatctgccggttcccggagcac
atcacccgctga

DBGET integrated database retrieval system