KEGG   Micromonospora sp. L5: ML5_4113Help
Entry
ML5_4113          CDS       T01379                                 

Definition
group 1 glycosyl transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mil  Micromonospora sp. L5
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ML5_4113
Enzymes [BR:mil01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     ML5_4113
Glycosyltransferases [BR:mil01003]
 Polysaccharide
  Storage polysaccharide
   ML5_4113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4342482..4343879)
Genome map
AA seq 465 aa AA seqDB search
MGGDPTRHRGDAAGVGTPQLKGGRVSADAEVIDIQPARRLRLLLLSWEYPPVLVGGLGRH
VHALSVALAAAGHEVTVVTRHAEGAPLEEYADGVRIVRAAEDPVRFPLATDSLLAWTMAF
NHTLTRAALRAASSGTYDVIHAHDWLVAHTAVTLAEHLDVPLVTTIHATEAGRHQGWLPE
EMNRTIHGVEHWLSNASGRVIACSGYMRDQVARLFGVPAGRIDVVANGVDDRAWRARPHA
VASARARFAAGGPLVGYAGRLVYEKGVQHLVHAVPHLAKRHPGLRVVIAGDGPYRDELVD
QARRLHVGDTVRFAGFMDATQLPAVLAATDATVIPSLYEPFGMIALEAAAAGAPLAVART
GGLAEIVEPGVTGVTFPHGDPDALAGAVDRLLGDEVFARRVARKARTMVSRRYTWSAIAA
RTAAAYATARRDHDAFQTRRATALLAGDRSPIAVPEGNLLAGAAS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgaccccacccggcaccgcggcgacgccgccggggtggggacgccacaactc
aaagggggccgcgtgtcagctgacgccgaagtgatcgacatccagcccgcccggcgcctg
cggttgctgctgctctcctgggagtacccgccggtgctcgtcggtggcctcggccgccac
gtccacgcgctgtcagtggcacttgccgccgccgggcacgaggtcacggtcgtcacccgc
cacgccgagggcgctcccctggaggagtacgccgacggcgtccgcatcgtccgggccgcc
gaggatccggtccggttcccgctcgccaccgattcgctgctggcctggacgatggcgttc
aaccacacgctcacccgggccgcgctgcgcgccgcctcgtccggcacctacgacgtgatc
cacgcccacgactggctggtcgcacacaccgccgtcacgctggccgagcacctggacgtg
ccgctggtgaccaccatccacgccaccgaggcgggccggcaccagggctggctgccggag
gagatgaaccgcaccatccacggcgtcgagcactggctgagcaacgcctccggccgggtg
atcgcctgctccgggtacatgcgtgaccaggtggcccggctgttcggcgtgccggccgga
cgcatcgacgtggtcgccaacggcgtcgacgaccgggcctggcgggcgcggccgcacgcg
gtcgcctccgcccgggcgcgcttcgccgcgggcgggccgctcgtcgggtacgccggccgg
ctggtctacgagaagggcgtgcagcacctcgtgcacgccgtgccgcacctggcgaagcgg
caccccggcctgcgggtggtgatcgccggggacgggccgtaccgcgacgagctggtcgac
caggcgcggcggctgcacgtgggagacacggtccggttcgccggtttcatggacgccacc
cagcttcccgcggtgctcgccgccaccgacgccacggtgatccccagcctctacgagccg
ttcggcatgatcgcgctggaggcggctgcggccggagcaccgctcgctgtggcgcgtacc
ggcgggctggccgagatcgtcgaacccggcgtcacgggggtgacgttcccgcacggcgac
ccggacgcgctggccggcgccgtcgaccggctgctcggcgacgaggtcttcgcccggcgg
gtggcgcgcaaggcccggaccatggtcagccggcgctacacctggtcggcgatcgccgcc
cggaccgccgccgcctacgccaccgcccgccgcgaccacgacgcgttccagacccgccgg
gccaccgccctgctggccggtgaccggtccccgatcgccgtcccggaggggaacctgctc
gccggcgcggcgagttag

DBGET integrated database retrieval system