KEGG   Micromonospora sp. L5: ML5_4307Help
Entry
ML5_4307          CDS       T01379                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mil  Micromonospora sp. L5
Pathway
mil00860  Porphyrin and chlorophyll metabolism
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ML5_4307
Enzymes [BR:mil01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ML5_4307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA VWA_CoxE AAA_5 MCM AAA_3 Sigma54_activat HRDC
Motif
Other DBs
NCBI-ProteinID: ADU09799
JGI: ML5_4307
Position
complement(4576540..4578522)
Genome map
AA seq 660 aa AA seqDB search
MPAQYPFCAVVGADDMTLALTLVAIDPLIGGVLIRGEKGTAKTTTVRGLAEVLPAVRVYA
GDRFSIDPDDPSAVCPDGPFDVPTPVVERPVRLVELPVGAGDDRVTGSLKLDAALRDGVV
AFEPGLLARAHRGLLYVDEVNLLPDHLVDLLLDAAATGRVSVERDGVSVEHASRFVLIGT
MNPEEGELRPQLLDRFGLTVEVAAPRDPVLRVQAVRRRLAFDADPEGFATRWAGEQEALR
TRLAAARRSLAGVVLDDETLTRIAELCAAFDVDGLRADLVTARAAAAHAAWRGRTRVTLE
DIRIAARLALPHRRRRNPFDEPGLDQDRLDDLLGHNDPDPGPDGPGGGLPDDTGHDGSAG
DVPGSPGESPPVPEPERQAATSMASAGEPARARLLVVKGTGDGQAGRRSRARTPQGRVAG
QRRRTSGDGRLHLPGTITAAAPHQHSRGGLTGGRGLALVPGDLRRAETVGRESNLVLLCV
DASGSMAARRRMEQVKTAVLSLLLDAYRRRDKVALVTFRRHTAEVVLPPTGSVDVASRRL
ADLPAGGRTPLAEGLERSGEVLRREALRDPSRRPLLVVVTDGRATSGPDPLGRAHRAAAA
LATSGVQVVVVDCETGRFRLGLAARLATHLRAEHVPLGEVTADGLTGVVRTATAPRAGVA
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgcagtaccccttttgtgccgtcgtcggcgccgacgacatgactctcgccctc
accctggtcgcgatcgatccgctcatcggcggtgtcctgatccgcggggagaagggcact
gccaagaccactaccgtgcgcggcctcgccgaggtgctcccggcggtacgggtctatgcg
ggcgaccggttctccatcgacccggacgatccctcggcggtctgccccgacgggccgttc
gacgtgcccacgcccgtcgtcgaacggccggtacgcctcgtcgaactacccgtcggagcc
ggcgacgaccgggtgaccggatcgctgaagctcgatgccgcgctgcgagacggcgtcgtc
gcgttcgagcctggcctgctggcccgggcccatcgtggcctgctgtacgtcgacgaggtc
aacctgctgccggaccacctggtcgacctgctgctcgacgccgcggcgaccggccgggtc
agcgtcgaacgcgacggtgtctcggtcgagcatgcctcccggttcgtgttgatcggcacg
atgaacccggaggagggcgaactgcgcccgcagctgctcgaccggttcggcctgacggtc
gaggtcgccgccccgcgtgaccccgtcctgcgggtgcaggcggtccgccgccggctcgca
ttcgacgccgacccggagggcttcgccacacgctgggccggcgagcaggaagccctgcgc
acccggctggccgccgcccggcgctcgctggccggtgtcgtgctcgacgacgagacgctg
accaggatcgccgagctgtgcgccgcgttcgacgtggacggcctgcgtgcggacctcgtc
accgctcgcgccgccgcggcgcacgcggcctggcggggacgtacgcgagtgacactcgag
gacatccgcatcgccgcccgtctcgcgctgccgcaccgccgccgccgcaaccccttcgac
gagcccggcctggaccaggaccgcctggacgacctactcggccacaacgaccccgacccc
ggacccgacggtcccggcggcggtctgcccgacgacaccgggcacgacggatcggccggg
gacgtgcccggctctcccggcgagagcccgcccgtaccggagcccgaacggcaggccgcc
acatcgatggcatccgcgggcgagcccgcacgtgcccgcttgctggtcgtgaaaggaacc
ggcgacggtcaggccggccggcggtcccgggcacgaacaccgcagggccgtgtcgccggg
cagcggcggcgcacgtccggcgacggccggctgcacctgccgggcaccatcaccgcggcg
gcgccgcatcagcattcccggggtggcttgaccggcggtcgcggcctcgcgctcgtgccc
ggcgacctgcgccgggccgagaccgtcgggcgcgagtcgaacctcgtgctgctgtgcgtg
gacgcgtccggttcgatggcggcccgccgccgcatggagcaggtcaagaccgctgtgctg
tcgctgctgctggacgcctaccgccgccgggacaaggtcgcactggtgacgttccgccgg
cacaccgccgaggtcgtcctgccaccgaccggctcggtcgacgtcgcctcccgccgcctg
gccgacctaccggccggtggccggaccccgctcgcggagggcctggaacgcagtggggag
gtgctgcgccgggaggcgctgcgcgacccgtcccgccggcccctgctcgtcgtggtgacc
gacggccgcgccacctccggcccggacccgctgggtcgtgcccaccgcgccgccgccgcg
ctcgccaccagcggtgtccaggtcgtcgtcgtggactgcgagaccggacgattccggctc
ggcctcgccgcccggcttgccactcatctgagggccgagcacgtgccgctcggtgaagtg
accgccgacgggctcaccggggtcgttcgcacggcgaccgctccgcgggcgggggtggcc
tga

DBGET integrated database retrieval system