KEGG   Micromonospora sp. L5: ML5_4326Help
Entry
ML5_4326          CDS       T01379                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
mil  Micromonospora sp. L5
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ML5_4326
Enzymes [BR:mil01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ML5_4326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4596719..4598749)
Genome map
AA seq 676 aa AA seqDB search
MSLPVTRKILFGGDYNPEQWPEDVWQQDYRLFDAARIDLVTLGVFDWALVQPAEDVYDFT
LLDRIVDRASAEGRSICLATGTAAHPPWLARAHPEVTRTDFEGRRHRFGQRHNSCPSSPV
FRRLSAELARRIARRYAGNPAIAAWHVGNEYGGACYCDLCAAGFRSWLRQRYRTIDELNS
AWYTTFWSHTFTDWDQIEAPSALTEHWRGPDHTAFAGITLDYLRFTSDAMLANFRDEKSA
IREYSPDIPVTTNFMGLYRPIDYHRWAPELDFASWDNYPPDDDSAARMALAHDLMRGLKD
GQPFWLMEQTPSSTACRDVNPLKRPGLLRLWSWQAVAHGADAVLFFQLRAARGACEKYHG
AVIGHAGRSDTRVFREVAELGAELDRLGAASLGARTPARVALLFDWDSWWALEISDGPSR
LVRYLEVVQRYHRALWDAGADLDVVPVTADLSRYDVVVAPVLHMLKGDLPRRLEAVAARG
GSVLTTFLSGRVDENDNAFLADVPGPLGELMGIRVDEWDARGPDVVNPVRLGSDDRLEVE
ARLLFELIVPQSAEVIGTYRADFYAGTPAVTRNTFGAGHGWYVGAGLDGTGVSWVVRQVL
ARHDLLGPAPDLPGLESATRVTPDGARLLFLLNHRSEPVEVAARSGGVDLLTGDRVDPGA
PLRLSARGVVVLREDE
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgagccttcccgtcacccgcaagattctcttcggtggagactacaaccccgagcagtgg
cccgaggacgtgtggcagcaggattaccggctgttcgacgccgcccggatcgacctcgtc
acgctgggggtgttcgactgggcgctcgtccagccggccgaggacgtctacgacttcacg
ctgctggaccggatagtcgaccgggcctccgccgaggggcggagcatctgcctggccacc
gggacagcggcgcatccgccctggctggccagggcacacccggaggtgacccgcaccgac
ttcgagggccgccgccaccggttcgggcagcggcacaactcctgccccagttcccccgtg
ttccgccgtctctccgccgagctggcccgccggatcgcccgtcgctacgccggcaacccg
gcgatcgccgcctggcacgtgggaaacgaatacggcggcgcctgctactgcgacctctgc
gcggccggcttccgcagctggttacgccagcgctaccgaacgatcgacgagttgaactcc
gcctggtacaccaccttctggtcgcacaccttcaccgactgggatcagatcgaggcgccg
tcggcgctgaccgagcactggcgcgggccggaccacaccgccttcgccggcatcacgctg
gactatctgcggttcacctccgacgcgatgctggccaacttccgcgacgagaaatccgcc
atccgggagtacagcccggacatcccggtcaccaccaacttcatgggcctgtaccgcccg
atcgactatcaccgctgggcgccggaactggacttcgcctcctgggacaactacccgccc
gacgacgactcggccgcccggatggcactggcacacgacctcatgcgtggactcaaggac
ggccagccgttctggctgatggaacaaacgccgagcagcaccgcctgccgggacgtcaat
ccgctgaagcgacccggcctgctgcggttgtggagctggcaggcggtggcccacggcgcc
gacgcggtgctgttcttccagctccgcgccgcgcggggtgcctgcgagaagtaccacggc
gcggtcatcggccacgccggccgctcggacacccgggtgtttcgcgaggtcgccgagctg
ggcgccgaactggaccggctcggcgcggcctcgctgggcgcccggaccccggcccgggtc
gcgttgctgttcgactgggacagctggtgggcgctggagatctccgacgggccgtcgcga
ctcgtccggtacctggaggtggtgcagcggtaccaccgtgcgctgtgggacgcaggggca
gacctcgacgtcgtcccggtgaccgcggacctgtcccgctacgacgtcgtcgtcgcgccg
gtgctgcacatgctcaagggcgatctgccgcgccggctggaggcggtcgctgcccgcggc
gggtcggtgctgaccacgttcctgtcgggccgggtggacgagaacgacaacgcgttcctg
gccgacgtacccgggccactcggcgagctgatggggatacgggtcgacgagtgggacgcc
cgcggccccgacgtggtcaacccggtccgtctcggcagcgacgatcggctcgaggtcgag
gcccggttgctgttcgaactaatcgttccgcagagcgcggaggtgatcggcacctaccgg
gccgacttctacgccggcacccccgcagtgacgcgcaacaccttcggtgccgggcacgga
tggtacgtaggcgcaggcctggacgggaccggcgtgtcctgggtggtgcgccaggtgctg
gcccgccacgacctgctcggccccgctccggacctgccgggtctggagtcggccactcgg
gtcacccccgacggagcccggctgctgttcctgctcaaccaccggtccgagccggtcgag
gtggccgcccgctccggcggggtcgacctgctcaccggagaccgggtcgaccccggcgcg
ccgctgcggctttcggcccggggggtggtggtgctgcgggaggacgagtga

DBGET integrated database retrieval system