KEGG   Micromonospora sp. L5: ML5_4416Help
Entry
ML5_4416          CDS       T01379                                 

Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
  KO
K16438  
epimerase EvaD
Organism
mil  Micromonospora sp. L5
Pathway
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    ML5_4416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(4693953..4694585)
Genome map
AA seq 210 aa AA seqDB search
MSSTMQARALKVEGAVEFTPRVFPDDRGIFVSPFQETAFVEALGHPLFPVAQTNHSRSRK
GVVRGAHFTLTPPGIAKYVYCARGKTIDFVVDIRVGSPTFGQFDQVLLDQEAFRAVYLPV
GVAHAFAALEDDTVVSYMLSDGYVEAHEKAVNVLDPALNLPLPTGVERVLSDRDRSAPTI
EEARRLGLLPDYAQCQKLESELFAAPRGRE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaccatgcaggcccgcgcactgaaggtcgaaggcgccgtcgaattcacccca
cgggtcttccccgacgaccgcgggatcttcgtctcgcccttccaggagaccgccttcgtc
gaggcgctcggccacccactctttccggtggcccagacgaaccacagccgctcacgcaag
ggcgtggtccggggcgcgcacttcaccctcaccccgcccggaatcgccaagtacgtgtac
tgcgcgcggggcaagacgatcgatttcgtcgtggacatccgagtcggttccccgaccttc
gggcagttcgatcaggtcctgctcgaccaagaggcgttccgggcggtctacctgccggtt
ggcgtggcccacgccttcgccgcgctcgaggacgacaccgtcgtgtcgtacatgctctcc
gacggctacgtcgaggcgcacgagaaggcggtcaacgtgctggacccggcgctgaacctg
ccgctgccgaccggcgtcgagcgggtgctctccgatcgggacaggtccgcgcccacgatc
gaggaggcccgcagactgggtctgctaccggactacgcacagtgccagaagctggagagc
gaactgttcgccgcgccccggggccgcgagtga

DBGET integrated database retrieval system