KEGG   Micromonospora sp. L5: ML5_4416Help
Entry
ML5_4416          CDS       T01379                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
  KO
K16438  
5-epimerase [EC:5.1.3.-]
Organism
mil  Micromonospora sp. L5
Pathway
Polyketide sugar unit biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ML5_4416
   01055 Biosynthesis of vancomycin group antibiotics
    ML5_4416
  Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    ML5_4416
Enzymes [BR:mil01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-  
     ML5_4416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(4693953..4694585)
Genome map
AA seq 210 aa AA seqDB search
MSSTMQARALKVEGAVEFTPRVFPDDRGIFVSPFQETAFVEALGHPLFPVAQTNHSRSRK
GVVRGAHFTLTPPGIAKYVYCARGKTIDFVVDIRVGSPTFGQFDQVLLDQEAFRAVYLPV
GVAHAFAALEDDTVVSYMLSDGYVEAHEKAVNVLDPALNLPLPTGVERVLSDRDRSAPTI
EEARRLGLLPDYAQCQKLESELFAAPRGRE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaccatgcaggcccgcgcactgaaggtcgaaggcgccgtcgaattcacccca
cgggtcttccccgacgaccgcgggatcttcgtctcgcccttccaggagaccgccttcgtc
gaggcgctcggccacccactctttccggtggcccagacgaaccacagccgctcacgcaag
ggcgtggtccggggcgcgcacttcaccctcaccccgcccggaatcgccaagtacgtgtac
tgcgcgcggggcaagacgatcgatttcgtcgtggacatccgagtcggttccccgaccttc
gggcagttcgatcaggtcctgctcgaccaagaggcgttccgggcggtctacctgccggtt
ggcgtggcccacgccttcgccgcgctcgaggacgacaccgtcgtgtcgtacatgctctcc
gacggctacgtcgaggcgcacgagaaggcggtcaacgtgctggacccggcgctgaacctg
ccgctgccgaccggcgtcgagcgggtgctctccgatcgggacaggtccgcgcccacgatc
gaggaggcccgcagactgggtctgctaccggactacgcacagtgccagaagctggagagc
gaactgttcgccgcgccccggggccgcgagtga

DBGET integrated database retrieval system