KEGG   Micromonospora sp. L5: ML5_4633Help
Entry
ML5_4633          CDS       T01379                                 

Definition
rok family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mil  Micromonospora sp. L5
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ML5_4633
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ML5_4633
   00052 Galactose metabolism
    ML5_4633
   00500 Starch and sucrose metabolism
    ML5_4633
   00520 Amino sugar and nucleotide sugar metabolism
    ML5_4633
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ML5_4633
   00524 Butirosin and neomycin biosynthesis
    ML5_4633
Enzymes [BR:mil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ML5_4633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5008549..5009448
Genome map
AA seq 299 aa AA seqDB search
MERPANPRLLGIDFGGTKMAIGVGDTDGRLLVSERLPTIAERGAQQALTRALDRACELAE
QTGGTIVAAGIASPGVVHDDGIELAPNVPGWEQLRLAEAVRAHLNLAHVRVTNDLKAAAY
AELRLGALRDADPGLVVGLGTGVAAAVTVNGEVLPGRHGAAGEIAYGLTDLSWPPRLEPM
LEATFSGRALDELAQRLGVDGRAAGLCAAAEQPGPVREQLRLRVDELARQLVTCCLLLDP
QRIVLVGSVAGNDLVRELLTERLTHTLPYPPEIVLSDFAQDAALLGALVMATEAQPAVV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaccggcaaatccgcgcctgctcggcatcgacttcggcggcaccaagatggcg
atcggcgtgggcgacaccgacggcaggctgctcgtctccgagcgcctgcccacgatcgcc
gagcggggcgcgcagcaggccctcacccgggcgctggaccgggcgtgcgaactcgccgag
cagaccggcggcacgatcgtcgcggccggcatcgcctcgcccggcgtcgtccacgacgac
ggcatcgaactggcgccgaacgtccccggctgggaacagttgcggctggccgaggcggtc
cgcgcccacctgaacctcgcgcacgtgcgggtgacgaacgacctgaaggcggcggcctac
gccgagctgcggctcggggccctgcgcgacgccgatccggggctcgttgtcgggctcggg
accggggtggccgccgcggtgacggtcaacggcgaggtgctgccgggccgccacggcgcg
gccggcgagatcgcctacggactgaccgacctcagctggccgccccgcctggaaccgatg
ctggaggcgacgttctccggccgggccctggacgagctggcgcagcgcctcggcgtggac
ggccgggcggccggcctgtgcgcggcagcggagcagcccggcccggtacgggagcagctc
cgcctgcgcgtcgacgaactggcccgccagctggtcacgtgctgcctgctgctcgacccg
cagcggatcgtgctggtcggcagcgtcgccggcaacgacctggtgcgggagctgctgacc
gagcggctcacccacacgctgccgtacccgccggagatcgtgctgtcggacttcgcgcag
gacgccgcgctgctcggcgcgctcgtcatggccaccgaggcacagcccgccgtggtctga

DBGET integrated database retrieval system