KEGG   Micromonospora sp. L5: ML5_4634Help
Entry
ML5_4634          CDS       T01379                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mil  Micromonospora sp. L5
Pathway
mil00071  Fatty acid degradation
mil00280  Valine, leucine and isoleucine degradation
mil00281  Geraniol degradation
mil00310  Lysine degradation
mil00360  Phenylalanine metabolism
mil00362  Benzoate degradation
mil00380  Tryptophan metabolism
mil00410  beta-Alanine metabolism
mil00627  Aminobenzoate degradation
mil00640  Propanoate metabolism
mil00650  Butanoate metabolism
mil00903  Limonene and pinene degradation
mil00930  Caprolactam degradation
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
mil01120  Microbial metabolism in diverse environments
mil01130  Biosynthesis of antibiotics
mil01212  Fatty acid metabolism
Module
mil_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ML5_4634
   00650 Butanoate metabolism
    ML5_4634
  Lipid metabolism
   00071 Fatty acid degradation
    ML5_4634
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ML5_4634
   00310 Lysine degradation
    ML5_4634
   00360 Phenylalanine metabolism
    ML5_4634
   00380 Tryptophan metabolism
    ML5_4634
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ML5_4634
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ML5_4634
   00281 Geraniol degradation
    ML5_4634
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ML5_4634
   00627 Aminobenzoate degradation
    ML5_4634
   00930 Caprolactam degradation
    ML5_4634
Enzymes [BR:mil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ML5_4634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADU10110
JGI: ML5_4634
Position
complement(5009519..5010268)
Genome map
AA seq 249 aa AA seqDB search
MSKVELHNADGRWTLTLNDPDRRNAIDAEMRDALGDAIAEVAADRHARTLVVTGAGTAFC
AGADLPAMFGEPGRSVAEIRADLHRVYDSFLRVRALPIPTIAAVQGPAVGAGLNLALACD
TRIVGPKAKLIASFTKLGLHPGGGCTWFLTRALGPERALQLLLDGGSVDGPEAVRVGLAA
TLADNPLAAAHERAERWAALDPALARDIKTSVRTAETAGFAAALEFESWAQASSATGPAI
QEAVAAFRR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtggaactgcacaacgcggacgggcgctggacgctcacgctgaacgacccg
gaccggcgcaacgccatcgacgcggagatgcgcgacgcgctcggcgacgcgatcgccgaa
gtggcggccgaccggcacgcccgcacgctcgtggtcaccggcgcgggcacggcgttctgc
gccggcgccgacctgcccgccatgttcggcgagcccggccggagcgtcgcggagatccgc
gccgacctgcaccgcgtctacgacagcttcctgcgggtacgggcgctgccgatcccgacg
atcgccgcggtgcagggaccggcggtgggcgccgggctgaacctggcgctcgcgtgcgac
acccggatcgtcgggccgaaggcgaagctgatcgcctcgttcacgaagctcggcctgcac
cccggcgggggctgcacctggttcctcacccgggcgctcggcccggaacgcgccctgcaa
ctgctgctcgacggcgggagcgtggacggccccgaggcggtacgcgtcgggctcgccgcg
acgctcgccgacaacccgctggcggccgcgcacgagcgcgccgaacggtgggcggcgctg
gacccggcgctggcccgggacatcaagacatcggtacgcaccgcggagacggccggtttc
gccgccgcgctggagttcgagtcgtgggcccaggcgtcctccgcgaccgggccggcgatc
caggaggcggtggccgcgttccgcaggtga

DBGET integrated database retrieval system