KEGG   Micromonospora sp. L5: ML5_4718Help
Entry
ML5_4718          CDS       T01379                                 

Definition
ricin b lectin
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mil  Micromonospora sp. L5
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mil00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mil00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mil00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5106549..5108204)
Genome map
AA seq 551 aa AA seqDB search
MRRWTRRTLAVLGVAAVALAATVTDQAVAPRPARALDNGVARTPPMGWNTWNTFGCNINE
TLIRQTADAIVSNGLRDLGYKYVVVDDCWFDPNRDSQGNLQAHPQRFPSGMKSLGDYLHA
RGLLFGIYQVPLDKTCAQVGGAFPGATGSLNHEYQDARQFAAWGVDYLKYDWCSSTGTIN
DQVARFGIMRDALASTGRPIVYSINPNSYHAKTGPQRNWSDVANLWRTTEDITNAWNTGQ
TNGYPMGIQNIVDVTVPLAGYAAPGGFNDPDMLEVGRGGMNDTEMRSHFALWAVLAAPLM
MGNDVRSANAATLAILRNANLVAINQDTLGRQAAQVSFDGTRRVLAKPLANGDVAVALFN
QGSSTTTVSTTAAAVGKSGSSFTLRDAWTDATSTSTGTISASVPAHGTVVYRVSGGGTTT
PPPVPTTFRLRSESSGRCLDVDNAGTANGTGTLIWDCHNNANQQFTANGQALQVLGKCLD
VPTNATAGTRVQIWDCNGGTNQQWTINGNGTVSNGRFPSLCLDVDNAGTANGTRVIVWTC
HGNANQRWSRA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcagatggacccgacggacgctcgccgtcctgggcgtcgcggcggtggcgctcgcc
gcgacagtcaccgaccaggccgtggccccgcgtcccgcccgggcgctggacaacggcgtc
gcccgcaccccgccgatggggtggaacacctggaacaccttcggctgcaacatcaacgag
accctcatccgccagaccgccgacgcgatcgtcagcaacggcctgcgcgacctcgggtac
aagtacgtcgtcgtggacgactgctggttcgacccgaaccgggactcgcagggcaacctc
caggcccacccgcagcggttccccagcgggatgaagtcgctcggtgactacctgcacgcc
cggggcctgctgttcggcatctaccaggtgccgctggacaagacctgcgcccaggtcggc
ggcgcgttccccggcgccaccggcagcctcaaccacgagtaccaggacgcgcggcagttc
gccgcctggggcgtggactacctgaagtacgactggtgctcgtccaccggcacgatcaac
gaccaggtggcgcggttcggcatcatgcgcgacgcgctggcctccaccggccggccgatc
gtctacagcatcaaccccaacagctaccacgccaagaccgggccgcagcgcaactggagc
gacgtggcgaacctctggcggaccaccgaggacatcaccaacgcgtggaacaccggccag
accaacggctacccgatgggcatccagaacatcgtcgacgtcacggtgcccctggccggg
tacgccgcgcccggcgggttcaacgacccggacatgctcgaggtcggccgaggggggatg
aacgacaccgagatgcgcagccacttcgcgctctgggcggtcctcgccgcgccgctgatg
atgggcaacgacgtacggtcggcgaacgcagccacgctggcgatcctgcgcaacgcgaac
ctggtcgcgatcaaccaggacacgctcggccgtcaggcggcccaggtctccttcgacggc
acccggcgggtgctggccaagccgctggccaacggcgacgtggcggtcgccctgttcaac
cagggcagctcgaccaccacggtctccaccaccgcggcggcggtgggcaagagcggcagc
tcgttcacgctgcgcgacgcgtggaccgacgccacctccaccagcaccggcacgatctcc
gccagcgtgcccgcgcacggcaccgtcgtctaccgggtcagcgggggcggcaccaccacg
ccgccgccggtcccgaccacgttccggctgcgcagcgagtcgtccggccggtgcctcgac
gtggacaacgccggcaccgcgaacggcaccgggacgctgatctgggactgccacaacaac
gccaaccagcagttcaccgccaacggccaggcgttgcaggtgctcggcaagtgcctcgac
gtgccgacgaacgcgacggccggcacccgggtgcagatctgggactgcaacggcggcacc
aaccagcagtggaccatcaacggcaacggcacggtgagcaacgggcgcttcccgtcgctg
tgcctggacgtcgacaacgcgggcaccgccaacggcacccgggtgatcgtgtggacctgc
cacggcaacgccaaccaacggtggagccgggcgtga

DBGET integrated database retrieval system