KEGG   Micromonospora sp. L5: ML5_4718Help
Entry
ML5_4718          CDS       T01379                                 

Definition
(GenBank) Ricin B lectin
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
mil  Micromonospora sp. L5
Pathway
mil00052  Galactose metabolism
mil00561  Glycerolipid metabolism
mil00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ML5_4718
  Lipid metabolism
   00561 Glycerolipid metabolism
    ML5_4718
   00600 Sphingolipid metabolism
    ML5_4718
Enzymes [BR:mil01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ML5_4718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 RicinB_lectin_2 Ricin_B_lectin Melibiase Raffinose_syn
Motif
Other DBs
NCBI-ProteinID: ADU10194
JGI: ML5_4718
Position
complement(5106549..5108204)
Genome map
AA seq 551 aa AA seqDB search
MRRWTRRTLAVLGVAAVALAATVTDQAVAPRPARALDNGVARTPPMGWNTWNTFGCNINE
TLIRQTADAIVSNGLRDLGYKYVVVDDCWFDPNRDSQGNLQAHPQRFPSGMKSLGDYLHA
RGLLFGIYQVPLDKTCAQVGGAFPGATGSLNHEYQDARQFAAWGVDYLKYDWCSSTGTIN
DQVARFGIMRDALASTGRPIVYSINPNSYHAKTGPQRNWSDVANLWRTTEDITNAWNTGQ
TNGYPMGIQNIVDVTVPLAGYAAPGGFNDPDMLEVGRGGMNDTEMRSHFALWAVLAAPLM
MGNDVRSANAATLAILRNANLVAINQDTLGRQAAQVSFDGTRRVLAKPLANGDVAVALFN
QGSSTTTVSTTAAAVGKSGSSFTLRDAWTDATSTSTGTISASVPAHGTVVYRVSGGGTTT
PPPVPTTFRLRSESSGRCLDVDNAGTANGTGTLIWDCHNNANQQFTANGQALQVLGKCLD
VPTNATAGTRVQIWDCNGGTNQQWTINGNGTVSNGRFPSLCLDVDNAGTANGTRVIVWTC
HGNANQRWSRA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcagatggacccgacggacgctcgccgtcctgggcgtcgcggcggtggcgctcgcc
gcgacagtcaccgaccaggccgtggccccgcgtcccgcccgggcgctggacaacggcgtc
gcccgcaccccgccgatggggtggaacacctggaacaccttcggctgcaacatcaacgag
accctcatccgccagaccgccgacgcgatcgtcagcaacggcctgcgcgacctcgggtac
aagtacgtcgtcgtggacgactgctggttcgacccgaaccgggactcgcagggcaacctc
caggcccacccgcagcggttccccagcgggatgaagtcgctcggtgactacctgcacgcc
cggggcctgctgttcggcatctaccaggtgccgctggacaagacctgcgcccaggtcggc
ggcgcgttccccggcgccaccggcagcctcaaccacgagtaccaggacgcgcggcagttc
gccgcctggggcgtggactacctgaagtacgactggtgctcgtccaccggcacgatcaac
gaccaggtggcgcggttcggcatcatgcgcgacgcgctggcctccaccggccggccgatc
gtctacagcatcaaccccaacagctaccacgccaagaccgggccgcagcgcaactggagc
gacgtggcgaacctctggcggaccaccgaggacatcaccaacgcgtggaacaccggccag
accaacggctacccgatgggcatccagaacatcgtcgacgtcacggtgcccctggccggg
tacgccgcgcccggcgggttcaacgacccggacatgctcgaggtcggccgaggggggatg
aacgacaccgagatgcgcagccacttcgcgctctgggcggtcctcgccgcgccgctgatg
atgggcaacgacgtacggtcggcgaacgcagccacgctggcgatcctgcgcaacgcgaac
ctggtcgcgatcaaccaggacacgctcggccgtcaggcggcccaggtctccttcgacggc
acccggcgggtgctggccaagccgctggccaacggcgacgtggcggtcgccctgttcaac
cagggcagctcgaccaccacggtctccaccaccgcggcggcggtgggcaagagcggcagc
tcgttcacgctgcgcgacgcgtggaccgacgccacctccaccagcaccggcacgatctcc
gccagcgtgcccgcgcacggcaccgtcgtctaccgggtcagcgggggcggcaccaccacg
ccgccgccggtcccgaccacgttccggctgcgcagcgagtcgtccggccggtgcctcgac
gtggacaacgccggcaccgcgaacggcaccgggacgctgatctgggactgccacaacaac
gccaaccagcagttcaccgccaacggccaggcgttgcaggtgctcggcaagtgcctcgac
gtgccgacgaacgcgacggccggcacccgggtgcagatctgggactgcaacggcggcacc
aaccagcagtggaccatcaacggcaacggcacggtgagcaacgggcgcttcccgtcgctg
tgcctggacgtcgacaacgcgggcaccgccaacggcacccgggtgatcgtgtggacctgc
cacggcaacgccaaccaacggtggagccgggcgtga

DBGET integrated database retrieval system