KEGG   Micromonospora sp. L5: ML5_4946Help
Entry
ML5_4946          CDS       T01379                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mil  Micromonospora sp. L5
Pathway
mil00010  Glycolysis / Gluconeogenesis
mil00020  Citrate cycle (TCA cycle)
mil00620  Pyruvate metabolism
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
mil01120  Microbial metabolism in diverse environments
mil01130  Biosynthesis of antibiotics
mil01200  Carbon metabolism
Module
mil_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ML5_4946
   00020 Citrate cycle (TCA cycle)
    ML5_4946
   00620 Pyruvate metabolism
    ML5_4946
Enzymes [BR:mil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ML5_4946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ADU10420
JGI: ML5_4946
Position
5357669..5359294
Genome map
AA seq 541 aa AA seqDB search
MTERTERSEGREGMPGRYSMTERTERSEGREGMPGRHGMSTAVGTRDFLLPDLGEGLSEA
EIVEWRVAVGDVVTVDQTVVEVETAKAVVDVPCPYAGRVVALHGAAGEVRPVGQPLITIA
PLDDAPDPHATYREEERAGSGNVLIGYGTGHGGTGRRRRRPRLALAPEPGTPVTADLASG
PAAGSPAPVGSQAPAGSPVPAGPVLAGSSRPAGSVSAGLSAPNGTAASADRTAEPEPTGV
QSAPLVISPIVRRLAKEHGIDLASLRGTGPGGVIRRADLDAAVAAPAAPAARLAAVPDAP
AAHVGLAPAGDGDTVIPLTGIRKVIADKLSRSRREIPEVTIWVDVDATGLLETRAAINAA
TPDTPVSILALLARICLSGLRKYPQLNAHVDTEGQRIVQSAGVHLGIAAQTDRGLVVPVL
RDAQRLTTRELAAALAETTAAARAGTLPPARLTGGTFTLNNYGVFGVDGSTPIINHPEAA
LLGVGRVVDKPWVVDGQLAVRKVTQISLTFDHRVCDGGVAGGFLRHVADCVEQPALLVAN
V
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgcaccgagcggagcgagggccgtgagggcatgcccggccggtacagcatg
accgaacgcaccgagcggagcgagggccgtgagggcatgcccggccggcacggcatgagc
acggctgtgggtacgcgggacttccttctgccggacctcggggaagggctgagcgaggcg
gagatcgtcgagtggcgggtcgcagtcggcgacgtggtcacagtggaccagacggtggtc
gaggtcgagaccgccaaggccgtggtcgacgtgccgtgcccgtacgccggccgggtcgtg
gccctgcacggcgcggccggtgaggtacgcccggtgggccagccgctgatcaccatcgcc
ccgctcgacgacgcccccgatccgcacgccacctaccgcgaggaggagcgggccggctcc
ggcaacgtcctgatcggctacggcaccggccacggcggcacgggtcggcggcggcgccgt
ccgcggctggcgctggcccccgagcccggtacgccggtcacggcggatctggcgtccggt
ccggcggccggctctccggctccggtgggctcacaggctccagcgggctctccggttccg
gccggcccggttctggccggttcatcgcgtccggcgggctcggtttcggctggcttgtcg
gctccgaacggcacggccgcctcggcggaccgcacggctgagccggaaccgaccggcgtg
caatcggcgccgctcgtcatctcgccgatcgtgcggcggctggcgaaggagcacggcatc
gacctggcgtcgctgcgcggcaccgggccgggcggcgtgatccgccgggccgacctggac
gccgccgtggccgcgcccgctgctccggcggcccggctggcagcggtgccggacgccccg
gccgcgcacgtcgggctcgccccggccggcgacggcgacactgtcatcccgctcaccggc
atccgcaaggtgatcgccgacaagctctcccgcagccggcgggagatccccgaggtgacc
atctgggtcgacgtggacgccaccggcctgctggagacgcgtgccgcgatcaacgcggcc
acccctgacacgccggtgagcatcctggcgctgctggcccggatctgcctcagcggcctg
cggaagtacccgcagctcaacgcgcacgtcgacaccgagggccagcggatcgtccagtcc
gcgggcgtacacctgggcatcgccgcgcagaccgaccggggcctggtcgtgccggtgctg
cgcgacgcgcagcggctcaccacccgggagctggccgccgcactcgccgagaccactgcg
gcggcccgggccggcacgctgccgccggcgcggctgaccggcgggacgttcacgctcaac
aactacggcgtgttcggcgtggacggctccacgccgatcatcaaccacccggaggcggcg
ctgctcggcgtcggccgggtcgtggacaagccgtgggtggtggacgggcagctcgccgtc
cgcaaggtgacccagatcagcctcacgttcgaccaccgcgtctgcgacggtggcgtggcc
ggcggcttcctgcgccacgtcgccgactgcgtcgagcagcccgccctgctggtcgccaac
gtctga

DBGET integrated database retrieval system