KEGG   Micromonospora sp. L5: ML5_5248Help
Entry
ML5_5248          CDS       T01379                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
mil  Micromonospora sp. L5
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mil00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5661555..5663555)
Genome map
AA seq 666 aa AA seqDB search
MPTKALWDDGRLCYGGDWNPEQWPPDVWREDVALMRAAGVNLVTVGVFAWSRLEPEPGRY
TLDWLDDVLDLLHSAGIRAALATPTASPPPWFSLRHPDALPLTADGVRLHHGSRDTYCAA
APAYRDAAHGIAEVLAARYAHHPALALWHVHNEYGTTCHCPHAETAFRHWLITRYGDLDA
LNDAWVTSFWSQHYSDWAQVGTPRATQYLANPGQLLDFRRFWSDTLLSAYTEQRDLLRAA
NPAVPVTTNYVLGDWVPVDHARWAREVDLVAIDHYPSATDLGAEEQTAFAADLARGWARH
GAGRPVPWLLMESAPNQIHTAGRMHTKEPGRMIRHSLAHVARGSAGVMFFQWRAPAGGAE
RFHSAVVSHAGADTRVFREAADLGAALGRLAGTAPGRVQAAVAIAYDAASGWALRHPGMP
RDGLDHPGEAAAVHRALWHAGVTADVVPPGVPLDDCRLLVLPALYLASDATVDWVRRHVH
GGGHLLVTWLSGVADEHARVRLGGYPGAYRDLLGVRVEEFHPLADDEHVPLTGGGTGRIW
SETVHPAGAETVSAYAGGVPAGRPAITRNRVGDAYAWYVSTRPDDDTYRGLLAEAARLAG
VAPACPGAPAGVEAVRRHDGLLYLLNHTDRPQPVPAAGFELLTGAAVDGELTVAPGGVAV
VREKTP
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgccaactaaagcgctgtgggacgacggccggctctgctacggcggcgactggaacccg
gagcagtggccgcccgacgtgtggcgcgaggacgtcgccctgatgcgcgccgccggggtc
aacctcgtcaccgtcggcgtgttcgcctggtcccggctggaacccgaacccggccgctac
acactcgactggctcgacgacgtgctggacctgctgcactcggccggcatccgggccgcc
ctggccacccccaccgcgtcgccgccaccctggttctcgctgcgccacccggacgccctg
ccgctcaccgccgacggcgtacgcctgcaccacggcagccgggacacctactgcgccgcc
gcgcccgcgtaccgggacgccgcccacggcatcgccgaggtgctcgccgcccgctacgca
caccacccggcgctcgcgctgtggcacgtgcacaacgagtacggcaccacctgccactgc
ccgcacgccgagacggcgttccgccactggctcatcacccggtacggcgacctcgacgcg
ctgaacgacgcctgggtcaccagcttctggagccagcactactccgactgggcgcaggtc
ggcaccccccgcgccacccagtacctcgccaaccccggccagctgctcgacttccgccgc
ttctggtccgacacgttgctgtccgcgtacaccgagcagcgggacctgctgcgcgcggcg
aacccggcggtgcctgtcaccaccaactacgtgctcggcgactgggtgccggtcgaccac
gcccgctgggcgcgcgaggtcgacctggtggcgatcgaccactacccgtccgccaccgac
ctgggcgcggaggagcagaccgcgttcgccgccgacctggcccgcggctgggcccgtcac
ggcgccggacggccggtgccgtggctgctgatggagagcgcgcccaaccagatccacacc
gccgggcgcatgcacaccaaggaacccggccggatgatccggcacagcctcgcccacgtc
gcacgcggctccgccggggtgatgttcttccagtggcgtgccccggccggcggggcggaa
cgcttccactccgcagtcgtctcgcatgccggcgccgacacccgcgtgttccgcgaggcc
gccgacctgggcgccgcgctgggccggctcgccgggaccgcgccgggccgcgtccaggcg
gcggtggccatcgcgtacgacgcggcgagcggctgggcgctgcggcacccgggaatgccc
cgcgacggactcgaccaccccggcgaggcggccgccgtgcaccgggccctgtggcacgcg
ggcgtcaccgccgacgtggtgccgcccggcgtcccgctcgacgattgccggctcctcgtg
ctccccgccctctacctggcctcggacgccacagtcgactgggtacgccggcacgtgcac
ggcggcgggcatctgctggtgacctggctcagcggcgtcgccgacgagcacgcccgggta
cgcctcggcggctacccgggcgcgtaccgggatctgctcggcgtgcgggtggaggagttc
caccccctcgccgacgacgaacacgtgccgctgaccggcggcgggaccggccggatctgg
tcggagacggtgcacccggccggcgcggagacggtcagcgcgtacgccgggggagtgccg
gcgggccgtcccgcgatcacccggaaccgggtcggcgacgcgtacgcctggtacgtctcc
acccgccccgacgacgacacgtaccgcggtctgctcgcggaggcggcccggctcgccggt
gtggccccggcctgccccggcgcgcccgcgggtgtggaggcggtacgccgccacgacggc
ctgctctacctgctcaaccacaccgaccggccgcagccggtgccggctgccgggttcgaa
ctgctcaccggcgcggctgtcgacggcgagttgacggtggcgccgggcggcgtggcggtg
gtacgcgagaagaccccgtga

DBGET integrated database retrieval system