KEGG   Micromonospora sp. L5: ML5_5342Help
Entry
ML5_5342          CDS       T01379                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mil  Micromonospora sp. L5
Pathway
mil00220  Arginine biosynthesis
mil00330  Arginine and proline metabolism
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
mil01130  Biosynthesis of antibiotics
mil01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    ML5_5342
   00330 Arginine and proline metabolism
    ML5_5342
Enzymes [BR:mil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ML5_5342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADU10814
JGI: ML5_5342
Position
5770978..5771868
Genome map
AA seq 296 aa AA seqDB search
MDHRQWTVVGAPSSAGAHTPGIERAPAALRAAGLLDLLGADVEDAGDVPGFRWRPDPAYP
RGQNAGAVAAVASAVADRVAAALGRGRAPLVLGGDCTVTVGLVAGCARAGLSPALVYVDG
GPDLYTPETRANGNLDAMGLAHMLGLPGTLPQVAGVGPEVPLLPPERVVVYGDSLPRGDH
ERELVAELGLAYVPADEVHADARAAARRARSVAEGAADRFVVHFDVDVLSFVDAPLADVP
EPFGLSLGEAAATLTELVASPRFAGLSVTEINPDHLPDDELLPRFAGVLAGALTGR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggatcatcgccagtggacggtcgtcggagcgccgtcgagcgccggcgcccacaccccg
ggtatcgagcgcgcacccgccgccctgcgcgccgcgggcctgctcgatctgctgggcgcc
gacgtcgaggacgccggtgacgtgccgggcttccggtggcggccggatccggcgtacccc
aggggtcagaacgcgggcgcggtggccgccgtcgcctcggcggtggccgaccgggtcgcg
gcggcgctgggccggggccgcgcgccgctggtgctcggcggcgactgcacggtgaccgtc
ggcctggtcgccggttgcgcgcgggccgggctgtcgcccgcgctggtgtacgtggacggc
gggccggatctctacacgccggagacccgcgccaacggcaacctggacgcgatggggctg
gcgcacatgctcggcctgccggggacgctgccccaggtggcgggcgtcgggcccgaggtg
ccgctgctgccgccggagcgggtggtggtgtacggggactcgctgccccgtggtgaccac
gagcgggagctggtggcggagctggggctggcgtacgtgccggccgacgaggtgcacgcc
gacgcgcgggcggcggcgcgccgggcccggtcggtggccgagggtgcggccgaccggttc
gtggtgcacttcgacgtggacgtgctgagtttcgtggacgcgccgctggcggacgtgccg
gagccgttcgggctcagcctcggcgaggcggcggcgacgctgacggagctggtggcgagc
ccgcggttcgccgggttgtcggtcaccgagatcaacccggatcatctgcccgacgacgag
ctgctcccccggttcgccggggtgctggccggggcgctgaccgggcgctag

DBGET integrated database retrieval system