KEGG   Micromonospora sp. L5: ML5_5814Help
Entry
ML5_5814          CDS       T01379                                 

Definition
pyridoxal-phosphate dependent trpb-like enzyme (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mil  Micromonospora sp. L5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ML5_5814
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML5_5814
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ML5_5814
Enzymes [BR:mil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ML5_5814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6284881..6286185
Genome map
AA seq 434 aa AA seqDB search
MTATKFVLPESDIPTTWYNVVPDLPKGLPPMLHPGTREPITPADLAPLFASELIAQEFST
ERDVDIPGPVLDIYRQWRPSPLIRARRLERDLDTPARIYFKYEGVSPAGSHKPNTAVPQA
YYSKLDGVRRLTTETGAGQWGSSLSMACAYFDLECEVFMVRVSYDQKPYRRGLMETFGAS
VTASPSDRTEAGRAVLATDPDSPGSLGLAISEAVEAALHSGGAARYALGSVLNLVLMHQT
IIGQEALAQMGLAGDYPDVVVGAAGGGSNFAGLALPFLRRQLDGGPAVRFLAAEPASCPS
LTRGSYDYDFGDTVGLTPLAKMHTLGHDFRPPAIHAGGLRYHGMAPIVSALSEVDLIEAR
AVPQTACFEAGVRFARSEGIVPAPESSHAVRVAVDEALRCRETGEEKAILFSLSGHGHFD
MQAYIDYFAGKLTD
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacgaagttcgtcctgcccgagagtgacatcccgacgacctggtacaacgtg
gttcccgacctgcccaaggggctgccgccgatgctgcaccccggcacccgggaaccgatc
accccggccgacctggcgccgctgttcgcctccgagctgatcgcgcaggagttctccacc
gaacgggacgtggacatccccggcccggtgctcgacatctaccggcagtggcggcccagc
ccgctgatccgggcccgccggctggaacgcgacctggacaccccggcgcggatctacttc
aagtacgagggggtcagcccggccggcagccacaagccgaacaccgccgtcccgcaggcg
tactacagcaagctcgacggggtgcggcggctgaccaccgagaccggcgccggccagtgg
ggcagctcgctgtcgatggcgtgcgcctacttcgacctcgagtgcgaggtcttcatggtg
cgggtcagctacgaccagaagccgtaccggcgcggcctgatggagacgttcggcgcctcg
gtcaccgccagccccagcgaccgtaccgaggccggacgggcggtgctcgccaccgacccg
gactcccccggcagcctcggcctggccatctccgaggcggtggaggccgcgctgcacagc
ggcggcgccgcccggtacgcgctcggctcggtgctcaacctggtgctgatgcaccagacg
atcatcgggcaggaggcgctggcgcagatggggctggccggcgactaccccgacgtggtg
gtcggcgcggccggcggcggctccaacttcgcgggcctggccctgccgttcctgcgccgc
cagctcgacggcggtccggccgtccggttcctggccgccgagccggcgtcctgcccgtcg
ctgacccggggcagctacgactacgacttcggcgacaccgtcgggctcaccccgctggca
aagatgcacacgctcggccacgacttccggccgcccgcgatccacgccggcgggctgcgc
taccacggcatggcgccgatcgtgagcgcgctgagcgaggtggacctgatcgaggcgcgg
gcggtgccgcagaccgcctgcttcgaggcgggcgtgcggttcgcccgcagcgaggggatc
gtgccggcgccggagtccagccacgcggtgcgggtcgccgtggacgaggcgctgcgctgc
cgggagaccggcgaggagaaggcgatcctgttctccctgtccgggcacggccacttcgac
atgcaggcgtacatcgactatttcgccggaaagctgacggactga

DBGET integrated database retrieval system