KEGG   Micromonospora sp. L5: ML5_5814Help
Entry
ML5_5814          CDS       T01379                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mil  Micromonospora sp. L5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ML5_5814
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML5_5814
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ML5_5814
Enzymes [BR:mil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ML5_5814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
6284881..6286185
Genome map
AA seq 434 aa AA seqDB search
MTATKFVLPESDIPTTWYNVVPDLPKGLPPMLHPGTREPITPADLAPLFASELIAQEFST
ERDVDIPGPVLDIYRQWRPSPLIRARRLERDLDTPARIYFKYEGVSPAGSHKPNTAVPQA
YYSKLDGVRRLTTETGAGQWGSSLSMACAYFDLECEVFMVRVSYDQKPYRRGLMETFGAS
VTASPSDRTEAGRAVLATDPDSPGSLGLAISEAVEAALHSGGAARYALGSVLNLVLMHQT
IIGQEALAQMGLAGDYPDVVVGAAGGGSNFAGLALPFLRRQLDGGPAVRFLAAEPASCPS
LTRGSYDYDFGDTVGLTPLAKMHTLGHDFRPPAIHAGGLRYHGMAPIVSALSEVDLIEAR
AVPQTACFEAGVRFARSEGIVPAPESSHAVRVAVDEALRCRETGEEKAILFSLSGHGHFD
MQAYIDYFAGKLTD
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacgaagttcgtcctgcccgagagtgacatcccgacgacctggtacaacgtg
gttcccgacctgcccaaggggctgccgccgatgctgcaccccggcacccgggaaccgatc
accccggccgacctggcgccgctgttcgcctccgagctgatcgcgcaggagttctccacc
gaacgggacgtggacatccccggcccggtgctcgacatctaccggcagtggcggcccagc
ccgctgatccgggcccgccggctggaacgcgacctggacaccccggcgcggatctacttc
aagtacgagggggtcagcccggccggcagccacaagccgaacaccgccgtcccgcaggcg
tactacagcaagctcgacggggtgcggcggctgaccaccgagaccggcgccggccagtgg
ggcagctcgctgtcgatggcgtgcgcctacttcgacctcgagtgcgaggtcttcatggtg
cgggtcagctacgaccagaagccgtaccggcgcggcctgatggagacgttcggcgcctcg
gtcaccgccagccccagcgaccgtaccgaggccggacgggcggtgctcgccaccgacccg
gactcccccggcagcctcggcctggccatctccgaggcggtggaggccgcgctgcacagc
ggcggcgccgcccggtacgcgctcggctcggtgctcaacctggtgctgatgcaccagacg
atcatcgggcaggaggcgctggcgcagatggggctggccggcgactaccccgacgtggtg
gtcggcgcggccggcggcggctccaacttcgcgggcctggccctgccgttcctgcgccgc
cagctcgacggcggtccggccgtccggttcctggccgccgagccggcgtcctgcccgtcg
ctgacccggggcagctacgactacgacttcggcgacaccgtcgggctcaccccgctggca
aagatgcacacgctcggccacgacttccggccgcccgcgatccacgccggcgggctgcgc
taccacggcatggcgccgatcgtgagcgcgctgagcgaggtggacctgatcgaggcgcgg
gcggtgccgcagaccgcctgcttcgaggcgggcgtgcggttcgcccgcagcgaggggatc
gtgccggcgccggagtccagccacgcggtgcgggtcgccgtggacgaggcgctgcgctgc
cgggagaccggcgaggagaaggcgatcctgttctccctgtccgggcacggccacttcgac
atgcaggcgtacatcgactatttcgccggaaagctgacggactga

DBGET integrated database retrieval system