KEGG   Micromonospora sp. L5: ML5_5844Help
Entry
ML5_5844          CDS       T01379                                 

Definition
fad dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mil  Micromonospora sp. L5
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    ML5_5844
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     ML5_5844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6321804..6323501)
Genome map
AA seq 565 aa AA seqDB search
METHEHVDAVVVGSGFGGSVAAYRLAEAGRRTVVLERGRPYPPGSFPRTPQEMGRAFWDP
SEGLYGLFDVWTFRGLESVVASGLGGGSLIYANVLLRKDEHWFVTEDPVPGAGHENWPVT
RADLDPHYDRVERMLGASRFPADRPPYRSVPKAAAMRTAAERLGLAYQYPPLAVSFAPGP
GAEPVPAALIAEPAYGNLHAAPRRTCRLCGECDIGCNDGAKNTLDHTYLSAARWHGAELR
TRAEVRSIRPRRGGGYEVRYLVHDPADEDRRSDGRARPGRTITCDRLVLAAGTYGTTYLL
LRNRHRLPAVGPALGTRFSGNGDLLGLIRPPRRGDATRFSASRGPVITTAIRVGDAHDGD
GSPGRGFYLQDGGYPGFVDWLAESSRLSGAPARRLRFAVDWLSARLTGSPRSGLGGGLAR
LLGDGRLSAGSLPILGMGRDVPDGVFRLRGDHLDVDWTTRTSAGYFAAVRSTMRAVADVL
GGRYTDNPAWWLRRVVTVHPLGGAPMGRHRGDGVCDGHGQVFGHPGLYVLDGSAMPGPVG
PNPALTIAAVADRALDRLLGEPAGR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggaaacccacgagcacgtcgacgcggtggtcgtcggctccggattcggcggctcggtc
gccgcgtaccggctggcggaggcgggccgccgcaccgtggtgctggagcgcgggcggccg
tacccgccgggcagcttcccgcgtacgccgcaggagatgggccgggcgttctgggatccg
agcgaagggctgtacggcctgttcgacgtgtggaccttccggggactggagtcggtggtg
gccagcggcctcggcggcggctccctgatctacgcgaacgtcctgctgcgcaaggacgag
cactggttcgtcaccgaggatccggtgcccggcgccggccatgagaactggccggtgacc
cgggccgacctggacccgcactacgaccgggtcgagcggatgctgggcgccagccggttc
ccggccgaccgtccgccgtaccgctcggtgcccaaggcggcggcgatgaggacggcagcc
gaacggctgggactggcgtaccagtacccgccgctcgcggtcagcttcgctccggggccg
ggcgcggagccggtcccggccgcgctgatcgccgagccggcgtacggcaacctgcacgcc
gcgccgcgccgcacctgccggttgtgcggagagtgcgacatcggctgcaacgacggcgcc
aagaacaccctcgaccacacctacctgtcggcggcccggtggcacggcgcggagctgcgg
acccgcgccgaggtccggtcgatccgcccccggcgcggcggcgggtacgaggtccggtat
ctcgtccacgacccggccgacgaggaccggcggagcgacggccgcgcccggccgggcagg
acgatcacctgtgaccgtctggtgctcgccgcgggcacgtacggcaccacgtacctgctg
ctgcggaaccggcaccggctgcccgccgtcggcccggcactcggcacccggttcagcggc
aacggtgatctgctcgggctgatccggccgccacgtcgcggcgacgccacccgcttctcg
gccagccgcgggcccgtcatcaccacggccatccgggtgggggacgcgcacgacggggac
ggctctccgggccgcggcttctatcttcaggacggcggctatcccgggttcgtggactgg
ctggcggagtcgtcccggctgtccggcgccccggcccgccggctgcggttcgctgtggac
tggctgtcggcccggctcaccggctcgccccgcagcggtctgggcgggggactggcccgg
ctgctcggcgacggccggctctccgccggctcgctgccgatcctcggtatgggacgggac
gtgccggacggcgtgttccggctgcgcggcgaccacctcgacgtggactggacgacccgg
accagcgccggctatttcgcggcggtccggtccacgatgcgagcggtggccgacgtcctg
ggtggccgctacaccgacaaccccgcgtggtggctgcgccgggtggtcaccgtccatccg
ctcgggggcgcgccgatgggccgccaccggggggacggggtgtgcgacgggcacggccag
gtgttcggtcatcccgggctctacgtgctcgacggctcggcgatgcccgggccggtggga
ccgaatccggcgctcacgatcgcggcggtggccgaccgggccctggaccggctgctgggg
gagccggcggggcggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system