KEGG   Micromonospora sp. L5: ML5_5990Help
Entry
ML5_5990          CDS       T01379                                 

Definition
protein-l-isoaspartate(d-aspartate) o-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mil  Micromonospora sp. L5
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6651998..6653230
Genome map
AA seq 410 aa AA seqDB search
MADPLDTELTEAARARLVDTLLADGAITSPAVEAAFRRVPRHLFTPSGASVEAAYADDVV
VTRRGPDGKATSSISAPWLQAAMLHAAHLQPGARVLEVGSGGYNAALIAEVVGPHGTVTS
IDIDPAVIAHARTALDTAGYPHVHTVHADADEGWAAAAPYDAIIVTVETSDIPPAWTDQL
APDGVLVAPLRMRGHTRCLTLVRDGVHLVATDALVCGFVPMQGAGANPVTPHRLRGDDVT
IFVDDPVTEALDLRALPAALDGPRHDAWSPVTTPPATPFDTLQLWLASQPHPHGLLAVDR
QRAADLAPQNWVACPALLTADSIAYLATRQLDHTTWQFGTHGYGPHATTLTGHMLDLITA
WDRHHRHQPGPHIAVYPTGTAPRPTNHLRLLIPRPHTTIAITWTSNGQPA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccgatccgctcgacactgagctcacggaggcggctcgcgctcgactggtcgacacg
ttgctcgccgacggtgcgatcacctcaccggccgtggaagcggccttcagacgggtcccc
cgccaccttttcacgccctcgggggccagtgtcgaggccgcgtacgcagacgacgtggtg
gtcacccgccgcggcccggacggcaaggcgaccagttcgatctccgcgccgtggcttcaa
gccgccatgttgcacgccgcccaccttcagcccggcgcacgggtgctggaggtcggatcc
ggcggctacaacgccgcgctcatcgcggaggtcgtcggcccgcacggcacggtcaccagc
atcgacatcgaccccgccgtcatcgcccacgcccgcaccgccctcgacaccgccggctat
ccgcacgttcacacggtgcacgccgacgcggacgaagggtgggcggcggccgccccgtac
gacgccatcatcgtcaccgtcgagaccagcgacatcccacccgcctggaccgaccagctc
gcccccgacggcgtcctcgtcgccccgctgcggatgcgaggccacacccgctgcctcacc
ctcgtccgcgacggcgtacacctcgtcgccaccgatgccctcgtctgcggcttcgtcccg
atgcaaggcgccggcgccaaccccgtcacaccacaccgcctacgcggcgacgacgtcacc
atattcgtcgacgaccctgtcaccgaggccctggatctccgcgcgctgcccgccgccctc
gacggaccgcggcacgacgcctggtcaccggtcaccaccccaccggcgaccccgttcgac
accctgcaactgtggctggccagccaaccccaccctcacggtctgctcgccgtcgaccgg
cagcgcgcagccgacctggcaccgcagaactgggtggcctgcccagccctgctcaccgcc
gacagcatcgcctacctcgccacccgccaactcgaccacaccacctggcagttcggcacc
cacggctacggaccccacgccaccacactcaccggccacatgctcgacctcatcaccgcc
tgggaccgccaccaccgacaccaacccggcccgcacatcgccgtctaccccaccggcacc
gcaccccgccccaccaaccacctgcggctactgatcccccgcccgcacaccaccatcgcg
atcacctggaccagcaacggccagcccgcataa

DBGET integrated database retrieval system