KEGG   Micromonospora sp. L5: ML5_6136Help
Entry
ML5_6136          CDS       T01379                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mil  Micromonospora sp. L5
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ML5_6136
Enzymes [BR:mil01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ML5_6136
Transfer RNA biogenesis [BR:mil03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ML5_6136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6825713..6826591
Genome map
AA seq 292 aa AA seqDB search
MGLVTEDEAGRLDDQRFAQWLATEAGRALTALRDRQGFADPKALKDAGDRASHELMTAAL
ARLRPADAVLSEEEADSRRAWADGERAPRHEADRVWIIDPLDGTREFSEEGRDDWAVHVA
LWQRSAAPDGALVAGAVGMPARTTVDGTPLVLGTTCPQPKASDGPIRIAVSRSRPPAFVG
ELVEMLGATAVPMGSAGVKVCAVVTGEVDAYVHAGGQYEWDSAAPVAVARGAGMHTSRID
GSPLRYNRADPRLPDLLVCRPELADQLLDAIARTGVEMPASTVTGDQGEAFG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggggctcgtgaccgaggacgaggcgggacggctcgacgaccagcggttcgcgcagtgg
ctggcgaccgaggccggcagggcgctcaccgcgctgcgggaccggcagggcttcgccgac
ccgaaggcgctcaaggacgccggcgaccgggcgtcgcacgagctgatgacggcggcgctg
gcccggctgcggccggccgacgcggtgctctccgaggaggaggccgactcgcgccgcgcg
tgggcggacggcgagcgcgcgccccggcacgaggcggaccgggtctggatcatcgacccg
ctggacggcacgcgtgagttctccgaggaggggcgggacgactgggcggtgcacgtggcg
ctctggcagcgctccgccgccccggacggcgccctggtcgccggcgcggtgggcatgccg
gcccggaccacggtggacggtacgccgctcgtgctcggcaccacctgcccgcagccgaag
gcgtccgacgggccgatccggatcgcggtgagccgcagccgcccgccggcgttcgtgggc
gagctggtcgagatgctcggcgccaccgccgtgccgatgggctcggccggtgtgaaggtc
tgcgcggtggtgaccggcgaggtcgacgcgtacgtccacgcgggcggtcagtacgagtgg
gacagtgccgccccggtcgccgtggcgcgcggtgcgggcatgcacacgtcccggatcgac
ggttcgccgctgcgctacaaccgggccgacccgcggctgcccgatctgctggtctgccgg
cccgaactggccgaccagttgctcgacgcgatcgcccggaccggggtcgagatgcccgct
tcgaccgtcaccggtgaccagggtgaggcgttcggctga

DBGET integrated database retrieval system