KEGG   Micromonospora sp. L5: ML5_6230Help
Entry
ML5_6230          CDS       T01379                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01151  
deoxyribonuclease IV [EC:3.1.21.2]
Organism
mil  Micromonospora sp. L5
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mil00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    ML5_6230
Enzymes [BR:mil01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.2  deoxyribonuclease IV
     ML5_6230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6925051..6925833
Genome map
AA seq 260 aa AA seqDB search
MRIGAHVDPTDPLAEAAARQAEAVQFFLADPQGWKAPKPREDAERLRSADVDLYVHAPYV
INVATLNNRIRIPSRKLLLAHASAAADVGARGLIVHGGHVNAGHDVAVGFDNWRKTFAYA
ADSGGFPLPVLIENTAGGDNACARHLDSLARLWDALGDHEVGFCLDTCHAYAGGEELLGL
VDRVKAITGRIDLIHANNSKGAFNSGQDRHDNLTGGTIDPELLVAVIRAAGAPVIVETPG
GVEGQAADIAFLRGQLGAAA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcggagcccacgtcgacccgaccgacccgctggccgaggcggccgcccggcag
gccgaggcggtccagttcttcctggccgacccgcagggctggaaggccccgaagccgcgc
gaggacgccgagcgcctgcgttccgccgacgtcgacctctatgtgcacgcgccgtatgtg
atcaacgtggccacgctgaacaaccggatccgcattcccagccgcaagctgctgctcgcc
cacgcgtccgccgcggcggacgtcggggccagagggctgatcgtgcacggcggccacgtc
aacgccggccacgacgtcgcggtcggcttcgacaactggcgcaagaccttcgcgtacgcg
gcggactccggcggcttcccgctgccggtgctgatcgagaacaccgccggcggtgacaac
gcctgcgcccggcacctcgactcgctggcccggctctgggacgcgctcggcgaccacgag
gtcggcttctgcctggacacctgccacgcgtacgcgggcggcgaggaactgctgggcctg
gtcgaccgggtgaaggcgatcaccggccggatcgacctgatccacgcgaacaactccaag
ggcgcgttcaactccggccaggaccggcacgacaacctcaccggcggcaccatcgacccg
gaactgctggtggcggtgatccgcgcggccggcgcgccggtgatcgtggagacccccggc
ggcgtcgagggccaggccgccgacatcgcgttcctgcgcggacagttgggcgcggcggcg
tga

DBGET integrated database retrieval system