KEGG   Methylacidiphilum infernorum: Minf_0068Help
Entry
Minf_0068         CDS       T00727                                 

Gene name
aceF
Definition
(RefSeq) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
min  Methylacidiphilum infernorum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Minf_0068 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Minf_0068 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    Minf_0068 (aceF)
Enzymes [BR:min01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Minf_0068 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64161..65390
Genome map
AA seq 409 aa AA seqDB search
MAVDIKMPSVGESIQSGLLGKWIKKEGERVSPGDALCEIETEKITTEIYAEKEGILHILV
DEGSEIKVGQVIARLEETPQEATEQKPAVLLTGKEEKAAGLASIPSYKEPGETLESPLEE
ELPEAVPLREPLKQPSRITREEALRNLNLEKEEIEEERQEIAEKIQPQKEVQPPTWDLKG
ARKRLSPIRVKIAQRLLEAHVGTAHLTTFNEVDMTTIVELRKNYGKKFEQKYGVKLGFMS
FFVCAVVEALKKIPEVGARIEGQELVYPSTLDLGIAVSTDRGLIVPVLRSAEELEFHQIE
KGIADLAQKAREGKVTLEDIEGGVFTITNGGIFGSLLSTPIINPPQSGILGMHAIKERPV
AVNGKVEIRPMMYLALTYDHRVIDGKEAVSFLVLIKEFLEQPASVLLGL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggccgtagatataaaaatgccttctgtaggagaatctatccagtcgggacttcttggc
aaatggatcaaaaaagagggagaaagggtttctccgggtgatgctttatgtgaaattgaa
actgaaaaaattacaactgaaatctatgctgaaaaagagggcattttacatatcttggta
gacgagggttcggagattaaagtcggtcaagtcatagctcggctggaggagacacctcaa
gaggcaactgaacaaaaacccgccgtccttctcaccggcaaagaagaaaaagcagccggt
ttagcttctatccctagctataaagaacctggagagaccttggaaagtcctttggaagaa
gaactcccggaggcagttcctttaagggaacctttaaaacagccatcccggattacaagg
gaagaagctttacgtaatttaaacctggaaaaagaagaaatagaggaagaaaggcaagag
atagcagagaaaatccagcctcaaaaagaggttcagcctcccacctgggatcttaaagga
gcaagaaaacggctcagtcccatccgggtgaaaattgcccagcgattgctcgaggcccat
gtagggacggcgcatttgaccacctttaacgaggtcgatatgaccacgatcgttgagttg
agaaaaaattatgggaaaaaattcgaacaaaaatatggggtcaagttggggttcatgtcc
ttttttgtttgcgccgtcgttgaggctttgaaaaaaattccagaagtaggagcaaggatt
gaaggtcaggaacttgtttatccttctaccttggatttgggaatagccgtttctactgac
cgtggattgatcgttcccgttcttcgctcggcagaagaactggaatttcatcaaatcgaa
aagggaattgctgatttagctcaaaaagccagggagggtaaagttacccttgaagacatt
gaagggggagtttttacgataaccaatgggggaatctttggctcattgctttctacccct
attataaatcctccccagagcggtatattgggtatgcatgcgatcaaggaaagaccggta
gccgttaatgggaaggttgagatcaggcccatgatgtacctcgctcttacttatgatcat
cgggtaatcgatgggaaggaagctgtgagtttccttgtgcttatcaaggaattcctagag
caaccggcttccgttcttctcgggttgtaa

DBGET integrated database retrieval system