KEGG   Methylacidiphilum infernorum: Minf_0068Help
Entry
Minf_0068         CDS       T00727                                 

Gene name
aceF
Definition
Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
min  Methylacidiphilum infernorum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:min01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:min00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:min00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64161..65390
Genome map
AA seq 409 aa AA seqDB search
MAVDIKMPSVGESIQSGLLGKWIKKEGERVSPGDALCEIETEKITTEIYAEKEGILHILV
DEGSEIKVGQVIARLEETPQEATEQKPAVLLTGKEEKAAGLASIPSYKEPGETLESPLEE
ELPEAVPLREPLKQPSRITREEALRNLNLEKEEIEEERQEIAEKIQPQKEVQPPTWDLKG
ARKRLSPIRVKIAQRLLEAHVGTAHLTTFNEVDMTTIVELRKNYGKKFEQKYGVKLGFMS
FFVCAVVEALKKIPEVGARIEGQELVYPSTLDLGIAVSTDRGLIVPVLRSAEELEFHQIE
KGIADLAQKAREGKVTLEDIEGGVFTITNGGIFGSLLSTPIINPPQSGILGMHAIKERPV
AVNGKVEIRPMMYLALTYDHRVIDGKEAVSFLVLIKEFLEQPASVLLGL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggccgtagatataaaaatgccttctgtaggagaatctatccagtcgggacttcttggc
aaatggatcaaaaaagagggagaaagggtttctccgggtgatgctttatgtgaaattgaa
actgaaaaaattacaactgaaatctatgctgaaaaagagggcattttacatatcttggta
gacgagggttcggagattaaagtcggtcaagtcatagctcggctggaggagacacctcaa
gaggcaactgaacaaaaacccgccgtccttctcaccggcaaagaagaaaaagcagccggt
ttagcttctatccctagctataaagaacctggagagaccttggaaagtcctttggaagaa
gaactcccggaggcagttcctttaagggaacctttaaaacagccatcccggattacaagg
gaagaagctttacgtaatttaaacctggaaaaagaagaaatagaggaagaaaggcaagag
atagcagagaaaatccagcctcaaaaagaggttcagcctcccacctgggatcttaaagga
gcaagaaaacggctcagtcccatccgggtgaaaattgcccagcgattgctcgaggcccat
gtagggacggcgcatttgaccacctttaacgaggtcgatatgaccacgatcgttgagttg
agaaaaaattatgggaaaaaattcgaacaaaaatatggggtcaagttggggttcatgtcc
ttttttgtttgcgccgtcgttgaggctttgaaaaaaattccagaagtaggagcaaggatt
gaaggtcaggaacttgtttatccttctaccttggatttgggaatagccgtttctactgac
cgtggattgatcgttcccgttcttcgctcggcagaagaactggaatttcatcaaatcgaa
aagggaattgctgatttagctcaaaaagccagggagggtaaagttacccttgaagacatt
gaagggggagtttttacgataaccaatgggggaatctttggctcattgctttctacccct
attataaatcctccccagagcggtatattgggtatgcatgcgatcaaggaaagaccggta
gccgttaatgggaaggttgagatcaggcccatgatgtacctcgctcttacttatgatcat
cgggtaatcgatgggaaggaagctgtgagtttccttgtgcttatcaaggaattcctagag
caaccggcttccgttcttctcgggttgtaa

DBGET integrated database retrieval system