KEGG   Methylacidiphilum infernorum: Minf_0269Help
Entry
Minf_0269         CDS       T00727                                 

Gene name
adhP
Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
min  Methylacidiphilum infernorum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Minf_0269 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Minf_0269 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    Minf_0269 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Minf_0269 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Minf_0269 (adhP)
   00626 Naphthalene degradation
    Minf_0269 (adhP)
Enzymes [BR:min01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Minf_0269 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
268840..269886
Genome map
AA seq 348 aa AA seqDB search
MPLKYRKIVIPMKALLLTTPSAIEKQPLRLEQVDIPYPKEDEVLVKIEACGVCRSNLHMI
EGEWLQRGIPAKLPIIPGHEIVGRVEDVGDRVRHFKKGDRVGLQPLWLSCGHCSYCWTGR
EELCPEKEITGETVDGGYAEYVLGKEDHLYPVPETLSAMEAAPLFCPGITAYHALKRVGN
VMGKRVAIFGIGGVGHMALQFARVAGATTIAISRNPIHLQVAKELGAEECIHGEDRSALE
KLKREGAVDCAIVFAPSSAVAQLAISLVNAGGKVVLGVNVELGSFSFVEEKTVLGTVIGS
REEMREVLRLAEERKVKPISQGFSLEDAPEALMKLKKGEIIMRAVLVL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgcccttaaaatataggaaaatagttatccccatgaaagccttgttgttaacaactccc
tctgcgatagaaaagcagcccttgcggttagagcaagtcgatatcccctatcccaaggaa
gatgaagtgttggttaaaattgaagcgtgtggagtttgtcgatccaatcttcacatgatc
gaaggagaatggctacaaagaggaattcccgcaaaacttcccattattccgggacacgag
atcgtgggtagggtggaggatgtgggcgatagggttaggcatttcaaaaaaggagatcgc
gtggggctacaaccgctttggctctcttgtggtcactgttcctattgttggacaggtaga
gaagaactttgcccggagaaagagatcacgggagaaaccgtagatggagggtatgcggag
tatgtattgggtaaagaagatcatttatatccagttcctgaaactctttcggctatggaa
gcagcgcctttattttgtcctggaattaccgcttaccatgcgctcaaaagggtgggtaac
gtgatgggcaagcgggtagccatttttggtataggcggggtggggcatatggccctgcag
tttgcccgagttgccggagcgaccaccattgctatttctagaaatcctattcatttgcag
gtcgcaaaagagttgggtgcagaagagtgcattcatggagaagatagaagcgctcttgaa
aaattaaaaagagagggagctgtagactgtgcgatcgtttttgccccttcaagcgctgtg
gcacagttggcaatctctttagtcaatgccgggggaaaggttgttttaggggtcaatgtt
gagcttggcagcttttcttttgtcgaggaaaaaaccgttttagggacggtcattggatca
agagaagaaatgagagaagtccttcgacttgcggaagaacgcaaagtcaagccgatcagc
cagggcttttcccttgaagatgccccggaggctttaatgaagcttaaaaagggcgaaatt
atcatgcgtgctgtcctggtgttataa

DBGET integrated database retrieval system