KEGG   Methylacidiphilum infernorum: Minf_0340Help
Entry
Minf_0340         CDS       T00727                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
min  Methylacidiphilum infernorum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Minf_0340 (folK)
Enzymes [BR:min01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Minf_0340 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
349934..350431
Genome map
AA seq 165 aa AA seqDB search
MCLFFPMYVGIALGSNEGQKNKHIEEALSFLRNLTINNHFLCSSIWETRPVDCPEGSPDF
LNCVAEIETDLPARTLLAFLQDFELSRGRLPLGSREKNGPRPIDLDILYYGGERVTENDL
IIPHPRIAQRLFVLGPLAEIRAELILPGYSKTVKELLYELDKNHS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtttattttttcctatgtacgttgggatagctttgggttctaacgaagggcagaag
aacaagcatattgaagaggccctgtcctttttaagaaacctgacaataaacaatcatttt
ctctgttcttcaatctgggaaacccggcctgtagattgtcctgaaggatcgcccgatttt
ctgaattgcgtagccgagattgaaacggatctccctgcaagaacgttacttgcttttctc
caggactttgagctttcccgtgggaggttgcctttggggagccgggaaaaaaacgggcca
cggccgatcgacttggacattttatattatggcggggaacgggttactgaaaatgatctg
attattcctcatccccggattgcccagaggctctttgtcctgggtcctcttgcagaaata
agagccgagttgattcttccgggctattccaagaccgtaaaagagttgctttatgaactc
gacaaaaatcactcctga

DBGET integrated database retrieval system