KEGG   Methylacidiphilum infernorum: Minf_0405Help
Entry
Minf_0405         CDS       T00727                                 

Gene name
argE
Definition
Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
min  Methylacidiphilum infernorum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Minf_0405 (argE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    Minf_0405 (argE)
Enzymes [BR:min01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Minf_0405 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
411379..412620
Genome map
AA seq 413 aa AA seqDB search
MPKGSTEWISKNREKLFSLLESLVRIPTINPPGEKYLEIVEFLDAEFRRLGLETQIIQVP
EETVKKQLGSASYPRYNFIARWNLRAEKTVLFNSHFDVVPVSGKWKHDPFGGQRDEKWIY
GRGSVDMKGPLAASIFALQAIKELKIDPVFNVEYALVADEEIGGELGSGYIVKNKLVNPD
FVIVCEGGLGKKIGVGHNGIIQLNVTVIGRASHTAYQDKALNSFLEAVNLVSFLEGFFKK
TMGEAKRVFVSPSREKLKPIVNIGGVVSSGPGAKINIVSSETSFTIDRRLTPSENLQEVE
EEIREAIEKWSKKRRTKVRIEVIHRTEPCAIGCDSDFTRAFKQAVEKIKGKKAVFTISRG
ATDMHFFVKGQKCQAVGYGVDGEDIHAIEERVSIDDLVKTAQVYAEFLCSPRP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagggttctactgaatggatttcaaaaaaccgggaaaagttgttttcccttctc
gaaagtcttgttcgtattccgaccatcaaccctcccggagaaaaatatttagagatagtg
gagtttttggatgcggagttccggcgcttgggattggaaacgcagattatccaagtaccc
gaggagacggtcaaaaagcagttgggatcggcttcttatccccggtataattttattgcc
cggtggaaccttcgagctgaaaaaactgttttgtttaattctcattttgatgtagtgccc
gtatccggaaaatggaagcatgatcccttcggagggcaacgagatgaaaagtggatatac
ggtagaggctctgtggatatgaaaggccccctggcagccagcatttttgccttgcaagcc
atcaaagaattaaaaatcgatcccgtttttaacgtggaatatgcccttgttgcggatgaa
gaaatcggaggggagttgggttcgggttatatcgttaaaaataagcttgttaacccagat
ttcgttatcgtttgtgagggaggcttagggaaaaagataggcgtagggcataatggaata
atccagctgaatgtcaccgttataggccgagcgtctcacacggcttaccaggataaagcc
ttaaactcttttctagaagcggtcaacctggttagctttctggagggattttttaaaaag
acgatgggagaagcaaaaagggtatttgtttctccatccagggaaaaactcaaacccatc
gtcaatatcgggggagtggtttcctctggccctggagcgaaaatcaacattgtttcctcg
gaaacttcttttaccatcgacaggagactgactccctcggagaatctgcaggaagtggag
gaagagatcagggaagcgattgaaaaatggtcgaaaaagagaagaacaaaggtgaggata
gaagttattcacaggacagaaccctgtgccattggttgcgattctgactttacaagggct
ttcaaacaagccgtagaaaaaataaaggggaaaaaggcggtctttaccataagcagaggg
gccacggatatgcattttttcgtcaaggggcaaaaatgccaagccgttgggtatggcgtg
gatggcgaagatatccatgccattgaagaaagggtttctatagatgatcttgtgaaaact
gcccaggtttatgcagagttcctttgctcgccccgtccttga

  All links  
No link information was found.   
DBGET integrated database retrieval system