KEGG   Methylacidiphilum infernorum: Minf_0501Help
Entry
Minf_0501         CDS       T00727                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
min  Methylacidiphilum infernorum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:min00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:min00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486048..486593
Genome map
AA seq 181 aa AA seqDB search
MKFTPLPLAGAFLIDLEKKEDPRGFFARVFCRREYEAHGLDPDIAQINTSLSLKKGTLRG
LHYQVFPKAETKVIRCLRGALWDVIVDLRPESKTYLCHYGCELNEENRRMVYVPRGFAHG
FLTLADNTEAYYLVGEFYSPEHERGIRYNDPALNITWPFEPLVISEKDRNYPDWNKEKAV
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttacaccgcttccccttgcgggggcttttttaattgacctggaaaaaaaagaa
gatccccggggtttttttgctcgagttttttgcagaagggaatatgaagcgcatgggctc
gatccggatattgcccagattaacacctctttaagcctgaaaaaggggaccttgcgtggg
ctccattaccaagtatttcccaaggccgaaaccaaggtcatccgttgcctgcggggagct
ctttgggacgtgatcgtggacttgcgtcccgaatccaaaacctatctctgccattacggt
tgtgaactcaacgaggaaaaccggcggatggtttacgtgccccgcggattcgcccatggt
tttttgactttagccgacaataccgaagcctattaccttgtaggggaattctattctccc
gaacatgaaagaggaatccgctataatgatccggctttgaacattacctggccttttgaa
cctcttgtgatttccgaaaaggatagaaattatcccgattggaacaaagagaaagcggtg
gaatga

DBGET integrated database retrieval system