KEGG   Methylacidiphilum infernorum: Minf_0613Help
Entry
Minf_0613         CDS       T00727                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
min  Methylacidiphilum infernorum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:min00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:min00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:min02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(594541..595956)
Genome map
AA seq 471 aa AA seqDB search
MNSFIRLGSFVFFIFTLSFSLLGEKTEGNYFPYGLSSGDPTAGSVIIWSRIESSLPSVEV
DYEVALDPEFKKIVKKGSLKTSPATDYTLKTDVQGLEPATTYYYRWSWNGHASPTGRTRT
LPLQAKNFRIALASCQHYGAGFYNAYRFIAQDNPDCILHVGDWIYEFPVYGTFCARPDPV
GTAVDLDSYRAKHRLYRTDPDLQEALKNIPLVALWDDHEVQNDYAGKALSFYNPDRMKAA
YTAYFEYLPVREQKEWKLYRSLKVGNLFELFLTDGRQYRDEDIWHPAIHPSLEALLQATA
LGRSMLGTEQRKWLIDSLKSSNAPWKFIASGDMMMEIKREGKPLNLDQWDGFDWERKEIL
RSIRENKVKNVIVLSGDSHIFSFGKVLLEGEPLALEIGTAGISSPAGKIEGKEELLKQNP
HVLFTDTDHRGYVLLDIGPEGMDIFFYGMTTVLSREAQRVLLKKIHIPRSL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaactcttttataagactgggatctttcgttttttttatttttactctttctttctcc
ctccttggagaaaagaccgaaggcaactatttcccttatgggttatcgagcggagatcct
acggccggtagcgttattatttggagccgaatagaaagttcccttccttctgtggaagtc
gattacgaagtcgcccttgatccggaattcaaaaaaatagtcaaaaagggcagccttaaa
acctccccggcaactgactacactttaaaaacggatgttcaaggccttgaacccgccacc
acctattattaccgttggtcatggaatgggcatgccagtcccacgggcagaacgagaact
ttacccctgcaggctaaaaattttcgaattgccctggccagttgtcaacactatggggct
ggattctataatgcttaccgatttatagcgcaagataatcccgactgcatcctccacgtt
ggcgactggatttatgaatttcccgtctacggcactttctgtgcaagacccgaccccgtg
ggaacggccgttgacctggactcttaccgggcaaaacacaggctttaccggacagatccc
gatctccaggaagccctcaaaaacattccccttgttgccctatgggacgatcacgaggta
caaaacgattatgcgggcaaggccctatccttctacaatcctgatcggatgaaagcagcc
tacaccgcctattttgaatacctgcccgttagagaacaaaaagaatggaagctttaccgt
tctttaaaagtgggcaatcttttcgaactcttcctgaccgacggaaggcaatacagggat
gaagacatttggcatcctgctatccatccttctttagaagcccttctccaagcaacggcc
ttgggccgatccatgctcggcaccgagcaaaggaaatggctgatcgattcattgaaatca
agcaacgccccttggaaatttatcgccagtggggatatgatgatggaaattaaacgggag
ggcaaacccttgaacttggatcaatgggatggatttgactgggaaagaaaggaaattctt
aggtccatccgggaaaacaaagttaaaaacgttatcgttttgagtggtgacagccacatt
ttcagctttgggaaggttctgctcgaaggagaaccgctcgctctagaaatcggcaccgcc
ggtatttcttctcctgcaggaaagatcgaaggcaaagaggaactgctcaagcaaaatccc
catgtccttttcaccgataccgatcaccgcggctatgtcttactggatatcggtccagaa
ggcatggatattttcttttatggaatgactaccgtcttaagcagagaagcccaaagggtc
cttctcaagaagattcatatccctcgttccctgtaa

DBGET integrated database retrieval system