KEGG   Methylacidiphilum infernorum: Minf_0746Help
Entry
Minf_0746         CDS       T00727                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
min  Methylacidiphilum infernorum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Minf_0746 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Minf_0746 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Minf_0746 (thrC)
Enzymes [BR:min01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Minf_0746 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(711990..713081)
Genome map
AA seq 363 aa AA seqDB search
MFKENNLKSWQGIINRYRDRLPLSGTTADITLLEGNTPLIPSLKLSRLAGKDLKVYFKYE
GLNPTASFKDRGMVVAMTKALEQKKQMVICASTGNTAASAAAYAARADLKCFVFLPRGKI
ALGKLSQAMVHGAEIVEVEGSFDDTMRLVIKLATLKPEIELVNSVNPSRIEGQKTAAFEI
CDVLGDAPDYHILPVGNAGNITAYWKGYKEYYESKLSKKLPQMLGFQAEGAAPLVEGRII
ENPTTIASAIRIGNPASWKGALAAARESSGNIDAVSDAEICEAYRFLADKEGIFVEPASA
VSVAGFLKACKENRIRPSSTIVMTLTGHGLKDPSFTESFSSSLPRHQIPPLIEKALQIVE
GRT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaggagaataacttaaagtcctggcaaggcataatcaatcgttatcgcgaccgt
cttcccttaagcggtactacggccgacatcacccttcttgaagggaatacccctttaatc
ccttctctaaaactatcccggcttgcgggaaaagacctcaaagtctatttcaagtatgaa
ggcctcaatcctaccgcttcctttaaagatcggggaatggtcgtggccatgaccaaggcc
ttggaacaaaaaaaacagatggtgatttgcgccagtaccggcaataccgcagcttctgca
gcagcctacgccgcaagggccgatttaaaatgctttgtttttcttcctcggggaaaaatc
gctttaggcaagctttcccaagccatggtccatggcgcggaaatcgtggaagtggaagga
agctttgatgacacgatgcgccttgttataaagttggcgacactaaaacctgaaattgaa
ctcgtcaattcggttaacccaagccggatcgaaggacaaaagacggccgcctttgaaatc
tgtgacgtgcttggagatgcacccgactatcatattttacccgtgggcaatgcgggaaac
atcaccgcttactggaagggctacaaagaatattacgaaagcaagttgtccaagaaactt
ccccaaatgctagggttccaggccgagggagctgctcctcttgtagaaggaaggatcatt
gaaaacccaacgacgatcgcttcggccataagaatcggtaacccggccagttggaaagga
gcattggcagcggcaagagaatcatccggcaatattgatgccgtgagcgatgctgaaatc
tgtgaagcctaccgttttttggccgataaggagggtatttttgtcgaacccgcctcggcg
gtatccgttgccggatttttaaaagcttgcaaagaaaaccggataaggccaagttccacc
atcgttatgacccttaccgggcatggattaaaagatccttcttttaccgaatctttttct
tcttccctcccacgccaccaaattcctcccttgatagaaaaagccctgcaaatcgtggaa
ggcaggacttga

DBGET integrated database retrieval system