KEGG   Methylacidiphilum infernorum: Minf_0746Help
Entry
Minf_0746         CDS       T00727                                 

Gene name
thrC
Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
min  Methylacidiphilum infernorum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:min01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:min00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:min00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(711990..713081)
Genome map
AA seq 363 aa AA seqDB search
MFKENNLKSWQGIINRYRDRLPLSGTTADITLLEGNTPLIPSLKLSRLAGKDLKVYFKYE
GLNPTASFKDRGMVVAMTKALEQKKQMVICASTGNTAASAAAYAARADLKCFVFLPRGKI
ALGKLSQAMVHGAEIVEVEGSFDDTMRLVIKLATLKPEIELVNSVNPSRIEGQKTAAFEI
CDVLGDAPDYHILPVGNAGNITAYWKGYKEYYESKLSKKLPQMLGFQAEGAAPLVEGRII
ENPTTIASAIRIGNPASWKGALAAARESSGNIDAVSDAEICEAYRFLADKEGIFVEPASA
VSVAGFLKACKENRIRPSSTIVMTLTGHGLKDPSFTESFSSSLPRHQIPPLIEKALQIVE
GRT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaggagaataacttaaagtcctggcaaggcataatcaatcgttatcgcgaccgt
cttcccttaagcggtactacggccgacatcacccttcttgaagggaatacccctttaatc
ccttctctaaaactatcccggcttgcgggaaaagacctcaaagtctatttcaagtatgaa
ggcctcaatcctaccgcttcctttaaagatcggggaatggtcgtggccatgaccaaggcc
ttggaacaaaaaaaacagatggtgatttgcgccagtaccggcaataccgcagcttctgca
gcagcctacgccgcaagggccgatttaaaatgctttgtttttcttcctcggggaaaaatc
gctttaggcaagctttcccaagccatggtccatggcgcggaaatcgtggaagtggaagga
agctttgatgacacgatgcgccttgttataaagttggcgacactaaaacctgaaattgaa
ctcgtcaattcggttaacccaagccggatcgaaggacaaaagacggccgcctttgaaatc
tgtgacgtgcttggagatgcacccgactatcatattttacccgtgggcaatgcgggaaac
atcaccgcttactggaagggctacaaagaatattacgaaagcaagttgtccaagaaactt
ccccaaatgctagggttccaggccgagggagctgctcctcttgtagaaggaaggatcatt
gaaaacccaacgacgatcgcttcggccataagaatcggtaacccggccagttggaaagga
gcattggcagcggcaagagaatcatccggcaatattgatgccgtgagcgatgctgaaatc
tgtgaagcctaccgttttttggccgataaggagggtatttttgtcgaacccgcctcggcg
gtatccgttgccggatttttaaaagcttgcaaagaaaaccggataaggccaagttccacc
atcgttatgacccttaccgggcatggattaaaagatccttcttttaccgaatctttttct
tcttccctcccacgccaccaaattcctcccttgatagaaaaagccctgcaaatcgtggaa
ggcaggacttga

DBGET integrated database retrieval system