KEGG   Methylacidiphilum infernorum: Minf_0795Help
Entry
Minf_0795         CDS       T00727                                 

Gene name
purN
Definition
(GenBank) Folate-dependent phosphoribosylglycinamide formyltransferase PurN
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
min  Methylacidiphilum infernorum
Pathway
min00230  Purine metabolism
min00670  One carbon pool by folate
min01100  Metabolic pathways
min01110  Biosynthesis of secondary metabolites
min01130  Biosynthesis of antibiotics
Module
min_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Minf_0795 (purN)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Minf_0795 (purN)
Enzymes [BR:min01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Minf_0795 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N ATP-synt_C
Motif
Other DBs
NCBI-ProteinID: ACD82850
UniProt: B3E154
Position
753253..753861
Genome map
AA seq 202 aa AA seqDB search
MTHQRRWINLAVLGSGKGSNFSAIAKAIAQGEIAAKIAVVVSDNPKALILEKARQLAIPA
VVLPQGKYKTWLEPWIEEELVRILKQYNTELVVLAGFMRVLKETFLASFEGKTLNIHPSL
LPDFKGKEAWKAALKAAVKETGCTVHWVSKELDGGKIIAQSKVPVYPADSPEELHARIQQ
AEHELYPRVLKEICLDWINQKL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgactcatcagagaagatggataaacctggcggtgctgggttcgggaaaaggaagcaat
ttttcagcgatcgccaaggccattgcccagggtgaaatagctgctaagatagccgttgtg
gtgtcggacaatcccaaggcattgattttggaaaaagcccggcagttggctatacccgcg
gtggtattgccccagggaaaatacaagacttggcttgagccttggatagaggaagaactg
gtaagaatcttaaagcaatacaatactgagctggttgtgctggcgggctttatgcgcgtg
cttaaggaaacttttcttgcttctttcgagggcaaaacattaaacattcatccttccctt
ttacccgactttaaaggaaaggaggcatggaaagcagcattgaaggcagcggtaaaggaa
acgggttgtacggtgcactgggtgagcaaggagctggatggaggtaaaattattgcccaa
tccaaggttcccgtttatcccgcagacagccctgaagaattgcatgcacggatacagcag
gcagaacatgagttgtatcctagggtgttgaaagagatatgcttggattggatcaatcaa
aagttgtaa

DBGET integrated database retrieval system