KEGG   Methylacidiphilum infernorum: Minf_0795Help
Entry
Minf_0795         CDS       T00727                                 

Gene name
purN
Definition
Folate-dependent phosphoribosylglycinamide formyltransferase PurN
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
min  Methylacidiphilum infernorum
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:min00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:min00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
753253..753861
Genome map
AA seq 202 aa AA seqDB search
MTHQRRWINLAVLGSGKGSNFSAIAKAIAQGEIAAKIAVVVSDNPKALILEKARQLAIPA
VVLPQGKYKTWLEPWIEEELVRILKQYNTELVVLAGFMRVLKETFLASFEGKTLNIHPSL
LPDFKGKEAWKAALKAAVKETGCTVHWVSKELDGGKIIAQSKVPVYPADSPEELHARIQQ
AEHELYPRVLKEICLDWINQKL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgactcatcagagaagatggataaacctggcggtgctgggttcgggaaaaggaagcaat
ttttcagcgatcgccaaggccattgcccagggtgaaatagctgctaagatagccgttgtg
gtgtcggacaatcccaaggcattgattttggaaaaagcccggcagttggctatacccgcg
gtggtattgccccagggaaaatacaagacttggcttgagccttggatagaggaagaactg
gtaagaatcttaaagcaatacaatactgagctggttgtgctggcgggctttatgcgcgtg
cttaaggaaacttttcttgcttctttcgagggcaaaacattaaacattcatccttccctt
ttacccgactttaaaggaaaggaggcatggaaagcagcattgaaggcagcggtaaaggaa
acgggttgtacggtgcactgggtgagcaaggagctggatggaggtaaaattattgcccaa
tccaaggttcccgtttatcccgcagacagccctgaagaattgcatgcacggatacagcag
gcagaacatgagttgtatcctagggtgttgaaagagatatgcttggattggatcaatcaa
aagttgtaa

DBGET integrated database retrieval system