KEGG   Methylacidiphilum infernorum: Minf_0808Help
Entry
Minf_0808         CDS       T00727                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
min  Methylacidiphilum infernorum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Minf_0808 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Minf_0808 (proB)
Enzymes [BR:min01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Minf_0808 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
770325..771122
Genome map
AA seq 265 aa AA seqDB search
MGTGVLSTAGGSLDLHQVENLTRQLIELKKKDIEVIVVSSGAIGCGMEILGYSKRPDTIE
ELQACSTLGQPFLMHYYKKFFSSYGFHVAQILVTYFDLDSLSLRSNIRKLLEYLLLKKTV
IPIINENDCVSYEEIRFGDNDRLSSHIAVLTKADRLVILSNVSGLMDYSNGEKKPIPFVD
EIDSRIEKLAEGTRSERSVGGMITKIEAAKIAVLAGIQMQIADGREKDVLIRIHEGETLG
TLFRVKNDARTFGADSQPLPKSQRG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgggaacgggagttttaagcacggccggaggctctcttgacctgcatcaagtggaaaac
ttgaccaggcagcttatcgaattaaaaaagaaagatatcgaggttatcgtcgttagctct
ggagccataggttgtggaatggaaatattaggctattctaaaagaccggataccattgag
gagcttcaagcctgctcgacgttgggccagccttttctcatgcattattacaaaaagttt
ttctcttcttatgggtttcacgtagcccagatccttgtgacctattttgacctggatagc
ctttctttacgatcgaacatcaggaagctgttagaatacttgttgcttaaaaagacggtt
atacccataattaatgaaaacgattgtgtgtcttacgaagaaatacgatttggagacaat
gaccggctgtcttcccacatcgccgtgttaactaaggccgataggttggtgatcctctcg
aatgtctccgggctcatggactatagcaatggagagaagaaacccattccttttgtcgat
gagatcgatagtcgaatagaaaaattggcggaagggacccggagtgaaaggtcggtagga
gggatgattacgaagattgaagcggctaaaatagcggttttggcaggaatccagatgcaa
attgccgatggaagagaaaaagacgttttgattcgaattcatgagggagaaactttagga
actcttttcagggtaaaaaacgatgcaagaactttcggagcagattcacagcctttgcca
aaaagccaaagaggctag

DBGET integrated database retrieval system