KEGG   Methylacidiphilum infernorum: Minf_0891Help
Entry
Minf_0891         CDS       T00727                                 

Gene name
aceA
Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
min  Methylacidiphilum infernorum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Minf_0891 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Minf_0891 (aceA)
Enzymes [BR:min01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Minf_0891 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
846141..847391
Genome map
AA seq 416 aa AA seqDB search
MILKRCNMLDKAQQLAREWAHAPRWKGIIREYSPEDVIRLSGSMAIEHTLAKQGSVLLWE
LLQRQEPVFALGALTGMQAVQMVRAGFKAIYCSGWQVAADANEAGEMYPDFSLYPSNSMP
LLVKRINASLRRADAIDFAESKRALHYFVPIIVDGEAGFGGILNVFELTKWLIEAGVAGV
HFEDQHPSAKKCGHMRGKVLLSIKEAIDKLKAARLAADISGVPTLIIARTDADGASFLSA
LEEDQRDRQFIERRTEEGLYAIKGGVDLAIARALAYAPYADIIWYESSKPDLSRAGRFAQ
ALHRAFPGKLLAYNCSSSFYWKEEMKEEQLRNFQKELFSLGYKLQVISLAGFHALCYGSF
KLAHACAEQGLLAYAEFQEKERGAATQGFSAFNHQQEVGAAYFERVYETIMGRKER
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttgatccttaaacgatgcaatatgctggataaagcacaacagttagcccgggaatgggcc
catgcgccgaggtggaaggggataataagggaatattcgccggaagatgtaatcaggcta
tccggctcgatggccatcgaacataccttggctaagcagggttctgtattgctttgggag
ctgttgcagcggcaagagccggtttttgcccttggagccttgacagggatgcaagctgtc
cagatggtcagggccggttttaaggctatttattgttcgggttggcaggttgccgcggat
gccaacgaagcgggggaaatgtacccggatttttccctttacccttccaattcgatgccc
ctgctcgtcaaaaggatcaatgcctccctgcggagggccgatgccatagattttgccgaa
tcaaaaagagccctccattactttgtgcctattatcgtggatggcgaagcgggttttgga
ggtatactcaacgtctttgaactgaccaagtggttgatcgaagcgggagttgccggggtc
cattttgaagaccagcacccctcggccaagaaatgcgggcatatgcgtggcaaagtcttg
ctttctataaaggaagcgatcgacaagcttaaagcagcccggctggctgccgacatatcc
ggggtgcctaccctcatcatagccaggacggatgccgatggggcatcctttttatcggcc
ttggaagaagaccaaagggataggcaatttatcgagagaaggacagaggagggactctat
gcgataaagggaggagtagatctggccatagcccgcgctttggcctatgctccctatgcg
gatataatttggtatgaaagttccaagcccgatctttcaagggccggccgttttgctcaa
gcccttcatcgggcttttccgggaaagcttcttgcttataactgttcctcttctttttat
tggaaagaagagatgaaagaggaacagctgcgtaattttcaaaaagagcttttttccctg
ggctataagttacaggttataagcttggcgggtttccatgcattgtgttatggtagcttt
aaattggctcatgcctgtgcggagcagggattgttggcttatgctgagtttcaagaaaag
gagaggggggcggccacgcagggcttcagcgcctttaaccatcaacaggaagtaggggca
gcttactttgagcgcgtttatgaaactatcatgggaagaaaagagagataa

DBGET integrated database retrieval system