KEGG   Methylacidiphilum infernorum: Minf_0891Help
Entry
Minf_0891         CDS       T00727                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
min  Methylacidiphilum infernorum
Pathway
min00630  Glyoxylate and dicarboxylate metabolism
min01100  Metabolic pathways
min01110  Biosynthesis of secondary metabolites
min01120  Microbial metabolism in diverse environments
min01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Minf_0891 (aceA)
Enzymes [BR:min01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Minf_0891 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACD82946
UniProt: B3DUE3
Position
846141..847391
Genome map
AA seq 416 aa AA seqDB search
MILKRCNMLDKAQQLAREWAHAPRWKGIIREYSPEDVIRLSGSMAIEHTLAKQGSVLLWE
LLQRQEPVFALGALTGMQAVQMVRAGFKAIYCSGWQVAADANEAGEMYPDFSLYPSNSMP
LLVKRINASLRRADAIDFAESKRALHYFVPIIVDGEAGFGGILNVFELTKWLIEAGVAGV
HFEDQHPSAKKCGHMRGKVLLSIKEAIDKLKAARLAADISGVPTLIIARTDADGASFLSA
LEEDQRDRQFIERRTEEGLYAIKGGVDLAIARALAYAPYADIIWYESSKPDLSRAGRFAQ
ALHRAFPGKLLAYNCSSSFYWKEEMKEEQLRNFQKELFSLGYKLQVISLAGFHALCYGSF
KLAHACAEQGLLAYAEFQEKERGAATQGFSAFNHQQEVGAAYFERVYETIMGRKER
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttgatccttaaacgatgcaatatgctggataaagcacaacagttagcccgggaatgggcc
catgcgccgaggtggaaggggataataagggaatattcgccggaagatgtaatcaggcta
tccggctcgatggccatcgaacataccttggctaagcagggttctgtattgctttgggag
ctgttgcagcggcaagagccggtttttgcccttggagccttgacagggatgcaagctgtc
cagatggtcagggccggttttaaggctatttattgttcgggttggcaggttgccgcggat
gccaacgaagcgggggaaatgtacccggatttttccctttacccttccaattcgatgccc
ctgctcgtcaaaaggatcaatgcctccctgcggagggccgatgccatagattttgccgaa
tcaaaaagagccctccattactttgtgcctattatcgtggatggcgaagcgggttttgga
ggtatactcaacgtctttgaactgaccaagtggttgatcgaagcgggagttgccggggtc
cattttgaagaccagcacccctcggccaagaaatgcgggcatatgcgtggcaaagtcttg
ctttctataaaggaagcgatcgacaagcttaaagcagcccggctggctgccgacatatcc
ggggtgcctaccctcatcatagccaggacggatgccgatggggcatcctttttatcggcc
ttggaagaagaccaaagggataggcaatttatcgagagaaggacagaggagggactctat
gcgataaagggaggagtagatctggccatagcccgcgctttggcctatgctccctatgcg
gatataatttggtatgaaagttccaagcccgatctttcaagggccggccgttttgctcaa
gcccttcatcgggcttttccgggaaagcttcttgcttataactgttcctcttctttttat
tggaaagaagagatgaaagaggaacagctgcgtaattttcaaaaagagcttttttccctg
ggctataagttacaggttataagcttggcgggtttccatgcattgtgttatggtagcttt
aaattggctcatgcctgtgcggagcagggattgttggcttatgctgagtttcaagaaaag
gagaggggggcggccacgcagggcttcagcgcctttaaccatcaacaggaagtaggggca
gcttactttgagcgcgtttatgaaactatcatgggaagaaaagagagataa

DBGET integrated database retrieval system