KEGG   Methylacidiphilum infernorum: Minf_0892Help
Entry
Minf_0892         CDS       T00727                                 

Gene name
aceB
Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
min  Methylacidiphilum infernorum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:min01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:min00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:min00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
847395..848945
Genome map
AA seq 516 aa AA seqDB search
MSIYSTPSGITIIGSYNKEWEKVLSYEALRFIGSLHRQFNGLLLELLERRKKTQRSLNEG
ASLGFLSGSLSIREEKWEVSAPPPVLRERKVEVITGAEDQIPSGGDWKEASGIIVDLEDG
LSPTWKNVIQSQLNLYNLLREEKAGGDGDLPVLHLRPRGIHLFEKHVHVDGEPIGACFFD
FGLYFFHNAKILAERQGGPFFYIPKIENQYEAEFWKTLFAFAENAFSLHPGTIRATIILE
TITAAFEIEEILYNLKNYVAAMVFEPRDYVFSVIRKLRNQRIALLPDRSEITIEAPFLKA
SLDLLAQSCHKRGTLALFELVPLMASLDERDNLEIFNKIREEQLRASSLGVDGYIVAHPR
LIPVVKAEIKDSIERRPAEAHSYGEKSIDCARDLLNFKIGGEITESGVRNNLSLVLRYLS
SWFSGKGAVEISNVKEDGSSAEVARSQLWQWIHLGAEMDSKIPLDKEIFLSWKTEEKELL
SPLPFLDKADKILEEVVLSRDFIDFLTLLAYEQLQD
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttattcaaccccttcgggcataacgattataggctcttataacaaggaatgg
gagaaggttctaagttacgaggctttacgttttatcggctcccttcaccggcagtttaac
ggacttcttttggaactcttggaaagaagaaagaaaacgcagcggtctttaaacgaaggc
gcctctttaggatttctttccggtagcctgtctattcgcgaagaaaaatgggaagtttca
gcccctccccctgttttgagagaaagaaaggtagaagtaatcaccggggcagaggatcaa
atcccttctggcggtgattggaaagaggcttcagggattattgtcgatttagaagatggc
ctatctcccacctggaaaaatgtgatccaaagccaactcaatttatacaatcttttgaga
gaagagaaggccggaggggatggcgatcttcctgtccttcatttaagaccaaggggaatc
catctttttgaaaaacatgttcatgtcgatggtgaacccatcggggcatgcttttttgat
ttcggcctctatttttttcataatgcgaagatccttgcggaaagacaaggagggcctttt
ttttatattccaaaaatagaaaaccaatacgaagcggagttttggaaaaccctttttgct
tttgccgagaatgccttttctttacatcctgggacgataagagccacgattatccttgaa
acgattacagcggcctttgaaatagaggagatcctttacaacttgaagaactacgtggcg
gcaatggtcttcgagcccagggattacgtctttagcgtgataaggaaactaaggaaccag
aggatagcactccttcccgataggtctgaaattactattgaagcgcctttcctgaaagct
tccttggatcttttggcacagagctgccataagagagggaccttggccctctttgaactt
gtgccgcttatggcctctcttgatgagcgggacaacctggaaattttcaataaaatcagg
gaggaacaactccgagccagttccctgggtgtcgatggatacattgttgctcatccccgg
ctcattcccgttgtcaaggccgaaattaaggactcgatcgagcgccgccccgcagaggcg
cactcctacggagagaaatccatagattgtgccagggacttgctcaactttaaaatcggt
ggagaaatcaccgaatcgggggtaagaaacaatctgagtttagttttgcgttacctttct
tcatggttttcgggcaaaggtgcagtggagatctccaatgtgaaggaggatggttcttct
gctgaagtagcccgcagccagctttggcaatggattcatcttggagctgaaatggattcg
aagatccctctagacaaagagattttcctttcttggaaaacggaagaaaaagaacttctt
agccctcttccttttttggacaaggcggacaagatccttgaagaggtcgttttgagcaga
gactttatcgattttcttacccttctagcctatgaacagctccaggattga

DBGET integrated database retrieval system