KEGG   Methylacidiphilum infernorum: Minf_0928Help
Entry
Minf_0928         CDS       T00727                                 

Definition
transcriptional regulator
Organism
min  Methylacidiphilum infernorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
885596..886036
Genome map
AA seq 146 aa AA seqDB search
MTILKKQFKILNMDGKVKRKVVIPTRNAEAARLVEKVFKCKWTVSVLELIGQGIYRPGQM
KKNIPGITTKVLSDLLKKLCQWGIIERIIYPVVPPKVEYQMTLFGKKFMKVLKSVEELQQ
EIDFNQARGVVVEEEDSFCTFHNGAK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
ttgactattttaaagaagcaatttaagattttgaatatggatgggaaggttaagcggaag
gtcgtaatccctacaaggaatgccgaagcggcgcgattggtcgaaaaagttttcaaatgc
aagtggacggtatccgtattggaattgattggccaaggaatctataggcctggtcaaatg
aaaaaaaacattcctggtattactaccaaggttctcagtgatcttttaaaaaagctctgc
cagtggggcattattgaaagaattatttatcctgtagttcctccaaaagtagaataccaa
atgacgttgttcgggaaaaaatttatgaaagttttaaaaagcgtggaggaacttcagcaa
gaaatagattttaaccaagcccgaggtgttgttgttgaggaagaggattcattctgcact
tttcataacggggctaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system