KEGG   Methylacidiphilum infernorum: Minf_0942Help
Entry
Minf_0942         CDS       T00727                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
min  Methylacidiphilum infernorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Minf_0942 (malQ)
Enzymes [BR:min01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Minf_0942 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(902358..904085)
Genome map
AA seq 575 aa AA seqDB search
MSSTLVMHRIIKNEKETGILAPVFALRRKNDLGIGDTKAVLSTIDFCHSLHINYLQVLPI
NETSEDNSPYNAMSSIAYDPMLLTLEPDAIPGLLEEDLKLTESEKLAFKERLIDYRLVKS
IKKKLLEKAYSRFTLSSSPSQRKDFALFCKNNKDWLSKYTLFRFLVEANDGNTRWNDWPE
EIQNYNNALSWFKRQKDKNRILEKRRFYAFIQWIAYKQWKNVRRYAEAKMVKLMGDIPFG
INRYSSDVWANQELFDCQWSCGAPPETFFQGDEFVKRWGQNWGFPLYRWENHEAESFRWW
RRRIIWTTKIFHAFRIDHVLGFFRIYAFPWLPEQNNEFLHLDMEEVKAKTGGLTPRFFPG
PDEPEESALVNKIQGEKILKVILETAKNEVVVAEDLGLVPGYVRPVLQAMGIPGFTIPMF
ERKPDLSYRPVKDYPFLTVATYGTHDHPSLASRYNFLVQKAAQNPHGEEMRELGRIALFI
GFPPSELPDYFDERVHLRFVEVLLNSPCWLVVFSINDLLGIELQFNHPGSNPKDNWRDRL
DKPLMDYLKEPEFGSKLKKIGQFIKQAQRSSCLNA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
ttgagctcaacccttgttatgcatcggataataaaaaacgaaaaagagaccggcattttg
gctcctgtctttgctttaagaagaaaaaacgatttgggcattggcgataccaaagccgtc
ctctctacgatcgatttttgccactccctccatatcaactatctccaagtactgcccata
aacgagacaagcgaagacaacagtccctacaatgccatgagttccatcgcttacgatcct
atgcttctcaccctcgagcccgacgctattcctgggcttttagaagaagatctcaagctt
acggaatccgaaaaacttgcattcaaagagaggttgatcgattaccggctcgttaaatcc
attaagaaaaaacttttagaaaaagcctattctcggttcacactttcttcttctccctct
caaagaaaggattttgctcttttttgtaaaaataacaaagattggctttcgaaatacact
cttttcaggtttcttgtagaagccaatgacggcaatacgcggtggaacgattggccggaa
gaaattcaaaattacaataatgctctgagttggtttaaaaggcaaaaggataaaaaccgc
attctggaaaagcggcgcttttatgcttttattcaatggatagcttacaaacagtggaaa
aacgtaagaagatacgcggaagcgaagatggtcaaactcatgggggatattccctttggt
attaacaggtatagttccgatgtttgggccaaccaagaactttttgattgccaatggagc
tgtggagcacctccggaaacttttttccagggtgatgaatttgtaaaaagatggggacaa
aattggggatttcccttgtatcgctgggaaaatcatgaagcggaatccttcagatggtgg
agacgaagaattatatggactacaaaaattttccatgcctttcgcatagaccatgtttta
ggctttttcagaatctatgccttcccatggcttcctgaacaaaataatgaatttctccac
ctggatatggaagaagtgaaagccaaaacaggaggccttacaccccgattctttcccggg
ccggatgagccagaagaatcggctctcgttaacaaaattcaaggagaaaagatcttaaaa
gtcatcctcgaaacggcaaaaaatgaagttgttgttgccgaggatcttggccttgttccc
ggctacgtaagacccgttctccaagcaatgggcattcccggttttactattcccatgttt
gaaagaaaacccgatctttcttaccggccggtcaaggattatcctttccttaccgttgct
acttacggcacacacgatcatccttctttagccagtcgatataacttccttgttcaaaag
gcagctcaaaacccccatggcgaagagatgcgcgaactgggccgcatcgccctttttatc
ggctttcccccttctgaactccctgattattttgatgaacgggtgcatcttagatttgtt
gaagtgcttctcaacagcccctgttggcttgtggttttttctataaatgatcttttgggt
atagaacttcaatttaaccatccgggatcaaacccaaaagataattggagagatcggtta
gacaagcccctaatggattatcttaaagaacccgaatttggttcaaaactaaaaaaaata
gggcaatttattaaacaagctcaaagatcgtcgtgcttaaatgcctag

DBGET integrated database retrieval system