KEGG   Methylacidiphilum infernorum: Minf_1024Help
Entry
Minf_1024         CDS       T00727                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
min  Methylacidiphilum infernorum
Pathway
min00500  Starch and sucrose metabolism
min01100  Metabolic pathways
min01110  Biosynthesis of secondary metabolites
Module
min_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Minf_1024 (glgB)
Enzymes [BR:min01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Minf_1024 (glgB)
Exosome [BR:min04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Minf_1024 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Malt_amylase_C AMPK1_CBM DUF3459 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ACD83079
UniProt: B3DUS6
Position
complement(974922..976949)
Genome map
AA seq 675 aa AA seqDB search
MDLASNEDNTVNLQAQGSKKTMMKKLTTPLLAPYKATPISLFSDYDIYLFKKGTHYNLYD
KLGCHLLKWKGKKGAYFAVWAPNAQSVSVIGSFNGWNPKTNPMSLREDQSGIWETFIPGV
AKGDLYKYHIVSKADGGVHVKGDPFAFLWEVPPKSASMVWNLEYTWLDKEWMDNKTKRNG
LNSPWNIYEVHLGSWKRKLEENNRFLNYREIALLLASYVKEMGYTHVEFLPVMEHPYYGS
WGYQTLGYFAPTSRYGFPQDFMFLIDYLHRNGIGVILDWVPSHFATDGHGLGVFDGTHLY
EHADPRQGYHPDWGSYIFNYGRYEVKEFLISSARFWFEKYHVDGLRIDAVASMLYLDYSR
KPGEWIPNKYGGNENLEAIDFLRTLNETLYKEFRGIQLIAEESTAYPMVTRPTYVGGLGF
GFKWNMGWMHDSLFYFSLDPIFRKYHQNRLTFSAWYAFQENFILSLSHDEVVYGKGSLLR
KMPGDNWQKFANLRALFSYQFFFPGHKLLFMGGEFGQWDEWYHEKSLDWHLASEGLHGQL
CSMVKYLNFLYKSEKALYGNNFSPKGFCWIDFSDYEKSIISFMRRSADGKEHILCVFNFT
PVPRENYIVGAPFKGYWKMIFNSDAPEYGGSGIGNSLGKEAVSLAWQGQPYSLSLTLPPL
ACLAFKKIHEDQPEN
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggatttagcctccaacgaggataacacggtcaatcttcaagcccaaggttcaaaaaaa
acaatgatgaaaaaattaacaacaccccttttggctccttataaagcaactcccattagc
ctttttagcgattacgatatttatctttttaaaaaaggaacccattacaacctttatgac
aagttaggatgccatcttctcaagtggaaaggcaaaaagggggcctattttgccgtatgg
gctcctaatgctcaatctgtttccgtcataggaagctttaacggctggaatcccaagaca
aaccccatgtcgcttagggaagatcagagcggcatctgggaaacatttattcccggggtg
gcgaagggagatctctacaaataccatatcgtgtcaaaagccgatggcggtgttcatgtt
aaaggcgatccctttgcctttttatgggaagtaccacccaaaagtgcttcaatggtgtgg
aacttggaatacacttggctcgacaaagaatggatggacaacaaaacaaaacgcaacggt
ttaaattctccttggaacatctacgaagtacacctgggatcgtggaaaagaaagctcgaa
gaaaataaccggtttcttaattacagggaaatcgcactactcttagccagctacgtaaag
gagatgggatatactcatgtcgagtttctccccgttatggaacatccctattacggttca
tggggttaccaaaccctaggatattttgctccgacaagccgttacggctttccccaagat
ttcatgtttttaatcgattatttacaccgtaatggtattggagtcatcctcgattgggtg
ccctcccattttgcaaccgatgggcatggactaggggtttttgacggcacacacctttac
gaacacgctgatcctaggcaaggttatcatcccgattgggggagttacattttcaactac
ggtcggtatgaagtaaaagagtttctgatcagcagcgctcgattctggtttgaaaaatat
cacgttgatggattgagaatagacgccgttgcttcgatgctttacctcgattattcaaga
aaacccggggaatggatacccaataaatatgggggtaatgaaaacctggaagctatcgac
tttttgcggacgctcaatgaaaccctgtataaagaatttcgtggaatacagcttattgcc
gaagaatcgacggcctaccccatggttacccgacctacatatgttggaggactaggcttt
ggattcaaatggaacatgggatggatgcatgatagtcttttttacttctctctggatccc
atttttaggaaataccaccaaaaccggcttacttttagtgcctggtacgcgttccaggaa
aacttcattttgtctctttctcatgatgaagtggtctacggcaaaggttctctgctaagg
aaaatgccgggagacaactggcaaaaatttgcaaacttaagagcccttttctcctatcaa
ttctttttccccggccataagctccttttcatggggggggaattcggccaatgggatgaa
tggtaccacgaaaagagtcttgactggcatttggcttcagaagggctccacggtcaactt
tgttccatggtaaaataccttaactttctctacaaatcggaaaaagctctttacggaaac
aatttttcccctaaaggcttttgctggatcgatttttcggactacgagaaaagcatcatc
agctttatgcgccgctctgccgatggcaaggaacacatcctctgcgtttttaattttact
cctgttcccagggaaaactacatcgtaggtgctccctttaaagggtattggaaaatgatt
ttcaacagcgatgctcccgaatacggcggtagcggtataggaaatagcttaggaaaagaa
gcggttagccttgcatggcaagggcaaccctattctctttctttaactcttcctccttta
gcttgtttggcatttaagaaaatccatgaagatcagcctgagaattaa

DBGET integrated database retrieval system