KEGG   Methylacidiphilum infernorum: Minf_1031Help
Entry
Minf_1031         CDS       T00727                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
min  Methylacidiphilum infernorum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Minf_1031 (tpiA)
   01230 Biosynthesis of amino acids
    Minf_1031 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Minf_1031 (tpiA)
   00051 Fructose and mannose metabolism
    Minf_1031 (tpiA)
   00562 Inositol phosphate metabolism
    Minf_1031 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Minf_1031 (tpiA)
Enzymes [BR:min01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Minf_1031 (tpiA)
Exosome [BR:min04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Minf_1031 (tpiA)
  Exosomal proteins of bladder cancer cells
   Minf_1031 (tpiA)
  Exosomal proteins of melanoma cells
   Minf_1031 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(984378..985157)
Genome map
AA seq 259 aa AA seqDB search
MRPVNIRKKIIAGNWKMNKTVSEAKAFMQVLLKELEEYSASDVVVCPPFTALQSVSDLLN
QSASQVRLGAQNLFPASHGAYTGEISPWMLREFFCHYVIVGHSERRIHLGETDIFINKKV
KAALSASLHPILCIGENFDERQQGLWKEKISTQLQLGLKEVEEQKLADCIIAYEPIWAIG
TGKNATPEQAQEVHHFIREEITRLFSFQSAQKVRIQYGGSVTAENAQDLLLCPDVDGLLI
GGASLDVRSFCSIILNSKF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagacccgtgaacatccgcaaaaagataatagccggaaactggaaaatgaacaaaacg
gtttccgaggcaaaagcttttatgcaggtcctcttaaaagagttagaggaatattctgct
tcagatgttgtcgtttgtcctccttttacggctcttcaatcggtaagtgatctgcttaac
caatccgcctcccaggttcgattaggggcccaaaatctcttcccggcttctcatggtgcc
tatacaggagaaatatccccttggatgctgagagaatttttttgtcattatgttatcgtc
ggtcactccgaaagaaggatccatcttggagaaaccgatatattcatcaacaagaaagtc
aaagccgccctctctgcttcacttcatcctatcctttgtattggagaaaattttgatgaa
cgccaacagggactatggaaagaaaagataagcacccagctccagctcggattaaaagaa
gtagaagaacagaaacttgccgattgtatcattgcctatgaacctatctgggctatcggc
acaggtaaaaatgctacaccggaacaggcccaggaagttcatcattttattagggaagaa
ataacgaggcttttttcttttcaatccgcccagaaagtacgcattcaatatggcggaagt
gtaacggccgaaaatgcccaagatcttcttctctgtcctgatgttgatgggttgcttatt
ggaggagcaagtcttgacgttcgttctttttgttcaataatattaaacagcaagttttaa

DBGET integrated database retrieval system