KEGG   Methylacidiphilum infernorum: Minf_1045Help
Entry
Minf_1045         CDS       T00727                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
min  Methylacidiphilum infernorum
Pathway
min00020  Citrate cycle (TCA cycle)
min00640  Propanoate metabolism
min00660  C5-Branched dibasic acid metabolism
min01100  Metabolic pathways
min01110  Biosynthesis of secondary metabolites
min01120  Microbial metabolism in diverse environments
min01130  Biosynthesis of antibiotics
min01200  Carbon metabolism
Module
min_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Minf_1045 (sucC)
   00640 Propanoate metabolism
    Minf_1045 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Minf_1045 (sucC)
Enzymes [BR:min01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Minf_1045 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACD83100
UniProt: B3DUU7
Position
997530..998717
Genome map
AA seq 395 aa AA seqDB search
MMNLLEYVAKEILAKEGVAIPRYGVAETPQEAFDIAIKLNTTPLVVKAQISAGGRAKGKF
VNGFEGGVKICNSPEEVKQVAEKMIGGLLVTAQTGTTGQPVRKVIVSESIDVAKELYLSL
TYSYAEAAILAMGSLAGGVNIERIALENPQALVKKYFYPEEPLWDFQLREFAAQLGFKGK
PLVDFSKILKSLFYAFINHDATLCEINPLALDKENRFWALDAKITIDDNSLFRRNELLGY
RFETVYDPQELEALRYGVNYVGLEGQIGCMVNGAGLAMATMDILERFGGKPANFLDVGGG
ADQSQLQNAFRVLLSNPNLKVILINIFGGIMRCDLIAEAIVEAAKNHPPKVPIIIRLEGT
RVEEGKKILKGSALQYVFAGDLEEAAKQAVYFLKR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaacttgttagaatacgttgccaaagagatattagccaaggaaggagtagcgata
ccccggtatggagttgcggaaactccccaggaagcttttgatatcgctataaagctcaat
acgactccactggttgtcaaggcccagatatccgctgggggaagggcaaaagggaaattt
gtcaacggctttgaaggtggagtaaaaatatgcaatagtcctgaagaagttaagcaagta
gctgagaaaatgattggtgggctacttgtcaccgcccaaacgggtacgaccggccagccg
gtgagaaaagtcattgttagtgaatctatagatgtggccaaagagctctatctttctctg
acttatagttatgctgaagcggctatactggctatggggagccttgccggtggagttaac
attgaaaggatcgccctggagaatccgcaagctttggtaaaaaaatatttttatcccgaa
gagcccctatgggattttcaattgagggaattcgccgctcagcttggttttaagggaaag
cctcttgtcgatttctccaagatcctcaaatctcttttttatgcttttatcaatcatgat
gctaccctttgcgaaattaacccgttagccctggataaagaaaatcgtttttgggctttg
gatgccaagataaccatagatgataatagcctttttcgacgaaatgagttgctcggttat
cggtttgagacggtttatgatcctcaagaactggaagcactgcgctacggggtaaattac
gtgggtctggaaggacagatcggttgcatggttaatggagcagggctagccatggccacg
atggatatcctcgagcgtttcgggggaaaaccggcaaattttctggatgttgggggcggg
gccgatcaaagccagctgcaaaatgcttttcgggttttgttatccaatccgaacttaaaa
gttattttgatcaatatttttggcggcattatgcgttgtgatctcattgcggaagctatt
gtagaagcggccaaaaatcacccccctaaggttcccataatcattaggctagaagggact
agggtggaggaaggaaaaaagatactaaaagggtctgctctccaatatgtttttgcagga
gacctggaagaagcggctaaacaagcggtttattttcttaaaaggtaa

DBGET integrated database retrieval system