KEGG   Methylacidiphilum infernorum: Minf_1083Help
Entry
Minf_1083         CDS       T00727                                 

Gene name
rbsK
Definition
Sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
min  Methylacidiphilum infernorum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Minf_1083 (rbsK)
Enzymes [BR:min01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Minf_1083 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1028053..1028970
Genome map
AA seq 305 aa AA seqDB search
MLWIVGSCNVDLTVNVESFPAAGETVLARESSLSIGGKGANQAVAAALWNVKPRFIGCVG
NDPWGKRVCQELSRYGLDVSLITVSESHPTGIAWIEIDEKGNNRITVAAGANFDLSADQV
LGNLAGLTSRDYLLSQLEVPLQTVESAFEYAKDKGAKTLLNPSPCVGRLNRLFSLTDYLV
LNERECCKLAAVSSFFDEKEKAKSFFFQWGISVLVVTTGASGAFVFEQGGSINHILPPVV
QVVDSSGAGDAFLGTFAAWIESGKTLEEALRAATVSGSLACTRRGTMSSFPQAQDVLLQL
SKTPL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctttggattgtgggaagctgcaatgtggatctgacggtaaatgtagagagtttcccc
gctgccggagaaacggtcctggctagggaatcttccttatccattggagggaaaggcgca
aaccaagctgtggccgctgctctttggaacgtaaagcctagatttatcggttgtgtcggt
aacgatccttggggtaaaagggtttgtcaagaactcagccgttatggtctagatgtttcg
cttatcactgtttcagaaagccatcctacgggaatagcttggatagaaattgacgaaaag
ggaaataaccggatcaccgtcgctgccggggcaaattttgatctttcggctgatcaagtc
cttgggaacctagcgggattgacatctagagattaccttttgagccaactcgaggttccc
cttcaaacggttgaatctgcttttgaatatgccaaggataaaggagctaaaaccctttta
aatccttctccctgcgtggggagattaaacaggcttttttctctgaccgattaccttgtt
ctcaacgagagggaatgttgcaagttggcggcagtctcttcttttttcgatgaaaaggaa
aaagcaaagtcctttttttttcaatggggaatttctgtcttggtggttacgacgggagcg
tcgggagcctttgtctttgaacagggggggagcattaaccatattttgcccccggttgta
caggtagtggacagctctggagcaggtgatgcctttttaggaacctttgctgcctggata
gaatcgggtaagactctggaagaagccctcagggcggctacggtttccggttcattggct
tgcacgcgcaggggaaccatgagttcatttcctcaagctcaggatgtgttgttgcaactt
tcaaaaactccgttatga

DBGET integrated database retrieval system