KEGG   Methylacidiphilum infernorum: Minf_1248Help
Entry
Minf_1248         CDS       T00727                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
min  Methylacidiphilum infernorum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Minf_1248 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Minf_1248 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Minf_1248 (thrC)
Enzymes [BR:min01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Minf_1248 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1171574..1172638
Genome map
AA seq 354 aa AA seqDB search
MWRYEAFLPLEESPTVGLHTGMTPLIRAQRLGKILGVKELYIKNDAINYPSLSFKDRVVS
VALSRARELNFSIVSCASTGNLANSLAANAASSGFKSYVLIPADLEPAKVIGSLVYKTKV
IGIRGSYDKVNRLCSEIAGKYRWAFVNVNFRPYYAEGSKTMGFEILEQMGWEIPDHTVIC
MASGSLLTKIDKAYREAIICGLVENKPYAIHGAQALGCNPITAAFKKGTDLIRPVPNPST
IAKSLAIGTPADGFYAIQTIRRTGGFSEDVNDLEIIEGIKILAETEGIFAETAGGVTVGC
AKKLIEKGHIPPSSKIVLCITGNGLKTADVLKDHLQPIQIIDPTIQDFDKIVAL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctacgaggcttttcttcctttagaagaaagtccaacggtgggattgcacacg
ggaatgactccccttatccgcgcccaaagactcggcaaaatactaggtgtaaaagaactc
tacatcaagaacgacgctatcaactacccttctctttcattcaaagacagggttgtttct
gtcgctttatcgcgagcccgagaacttaatttttccattgtatcctgtgcatcgacggga
aaccttgccaatagcttggctgctaatgcggcaagcagtggatttaaaagctatgtcctt
attcctgctgatcttgaaccggcgaaagtgatcgggagtctcgtttacaaaacaaaagtg
atcggcatccggggttcatacgataaagtcaatcgcctctgttcagaaatagcgggtaaa
tacaggtgggcttttgtaaacgtcaattttaggccctattacgctgaaggatctaaaacc
atgggatttgagatcctcgaacagatgggatgggaaattcctgatcacaccgtgatctgt
atggccagtggttctctactcacaaagatcgataaagcttatagagaggcgattatttgt
gggctggtcgaaaacaagccctatgccattcacggcgcccaagccctgggttgtaatcct
attacggctgcctttaaaaaaggaacagatttaataagaccagtccccaatcccagcaca
attgccaagtctctagctataggtactccggcagacggcttttatgccatacaaacgatt
cgcagaacaggaggcttttctgaagatgtcaatgaccttgaaattattgaagggataaaa
attttagctgaaaccgaaggcatttttgctgaaaccgctggaggagtaacggtcggatgt
gcgaaaaaactgattgaaaaaggccatatacctccatcaagtaaaattgtattgtgcatt
acgggcaacggcttaaagactgcagacgttcttaaagatcatctgcaacccatacagatt
atcgatccaaccatccaggatttcgacaaaattgtggctttataa

DBGET integrated database retrieval system