KEGG   Methylacidiphilum infernorum: Minf_1748Help
Entry
Minf_1748         CDS       T00727                                 

Gene name
bglX
Definition
Beta-glucosidase-related glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
min  Methylacidiphilum infernorum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:min00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:min00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1632895..1634016
Genome map
AA seq 373 aa AA seqDB search
MNGYSTSTNALRDGGRFLIIGLPGAHLSQDQIQTIREIQPSGFIFFSRNLENPLSFRNLL
EQLRSLVEHEPIFAIDQEGGRVSRLKAFGSEPPGAKELGEKADLDLLREHGELTGKLLRL
FGLNFDLAPVLDMDTSEREHNSLKGRSFAPDPQDVSRFAKAFIEGLKSQGILCCGKHFPG
YSFAQCDPHLELPQSFKSKKELESFEWIPFRALQNSCDSFMIAHIRNFNLDPQGLPATLS
SRMISIIRQEWQFTQLLVSDDIDMGAIINHYSLKDTLELSLKAGIDILLLCHRFHLVREA
AAILSSFPESIKEEAAQRIENFRNRLAPPLAFSLELFQSIDHEIYSLREKVLGKERAKQR
SIEDGKRSPVEIY
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaatggatactctacttctacaaatgctctccgcgatggaggaagattcctcatcata
ggacttcccggagcccacctttcccaggaccagattcaaaccattcgcgaaatacagcct
tcaggattcatttttttttctaggaacctggagaatcccctttctttcagaaaccttctt
gagcagttaagatccctggtcgagcatgaacccatctttgcaattgaccaagaaggggga
agagtctctaggttaaaagcttttgggagcgaacctcccggggcaaaagaactgggggaa
aaagctgacctcgatcttcttagagaacatggagaactgacggggaagttattacgtctt
ttcggtctaaactttgaccttgctcccgtactcgatatggacacgagcgagcgcgagcat
aattctttgaaaggacgatcttttgcccctgatcctcaggatgtctctcgttttgccaag
gccttcatagaagggttaaagtcccaagggattctttgctgtggaaaacattttcccggt
tacagctttgcccaatgtgatcctcacctcgaattaccccaatcttttaaatcgaaaaaa
gaactcgaatcttttgaatggattccctttagagctcttcaaaactcctgcgatagcttc
atgatcgcccacatccgcaacttcaacctggatcctcaaggcttacctgctaccctatct
tctcggatgattagcattataaggcaagaatggcagtttactcaactcctcgtttccgat
gatatagacatgggcgccatcatcaaccactactccttaaaagataccctagaattatct
ttaaaagccggtatagacattctccttctttgtcatcgtttccatttagttagagaagcc
gctgccattctcagttcattccccgaatcgatcaaggaagaagcggctcaaagaatcgaa
aatttcaggaaccgtcttgccccccctttagctttctcactagagctatttcaatccatc
gaccatgaaatctactcgcttcgcgaaaaggttcttgggaaagaaagagcaaaacaaaga
tctatagaggatgggaagcgatcacccgttgaaatttattga

DBGET integrated database retrieval system