KEGG   Methylacidiphilum infernorum: Minf_1835Help
Entry
Minf_1835         CDS       T00727                                 

Gene name
frvX
Definition
(GenBank) Cellulase M or related protein
Organism
min  Methylacidiphilum infernorum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1712861..1713958
Genome map
AA seq 365 aa AA seqDB search
MKKESFEFLLSLLNTPSPSSLETLGQKVWIDYVKNYAHRVEVDAYGNAVATLNLEGKPKI
LVNGHIDEIAFQVQYVDDNGFIYFSPVGGPDPKLSRGRKVNIFHEGKVVPGVIGTLAIHM
QEKEGQEKTPKWNELFIDIGASSRDEALEHVQVGDLVLYDSEAFCLLNDIWISRGCDDKV
GAFVAAEVLRICSEEKISAPCIVAASTIQEENGLYGASMIGYSIHPDIAIVVDVGHATDI
PIADKKKFGDIRLGKGPILSHGSVNHPGIVDYLNKLAHKLSLSHQHGIDPRRSGTDADAL
FIQRGGIPSCSIGIPNRYMHSPVEAFHLKDLETAATWIAAFCKEIKSREEILPSIEKEPF
LEKRF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagtcctttgaattccttttatctctcttgaatacccccagtccttcgagc
ctggaaaccttggggcaaaaagtatggattgattacgtaaaaaattatgcccaccgcgta
gaagtagatgcttatggcaacgccgtggcgactttaaacttggagggcaaacctaaaatt
cttgtcaatggccatatcgatgaaatcgctttccaagtccaatatgtcgatgacaacggt
tttatttatttttcccctgttggtggacctgatccaaaactttccaggggaagaaaagtg
aacattttccatgaaggcaaagttgttcccggtgtaattggtactcttgccatccatatg
caggagaaggaagggcaggaaaaaactccgaaatggaacgagctttttatcgatattgga
gcatcaagtagggatgaagcccttgaacatgtccaagttggagatctcgttctttacgat
agcgaggctttctgccttttaaacgatatctggatatcccgtggatgcgacgacaaggtt
ggggctttcgtcgccgcagaagttttgagaatctgctcggaagaaaaaatatccgctccc
tgtatcgttgccgcttccaccatccaggaggaaaatggactttacggagcgagcatgatc
ggatactccatccaccccgatattgccatcgtagtcgatgttggccatgcaaccgatatt
cccatagcggataagaaaaaattcggcgatattcgtcttgggaagggccccatcctcagt
catggtagtgtcaatcatcctggaatagtggactacctgaataaactcgcccacaagctt
tcccttagccatcagcatggcattgatcccaggcgatcgggaacagatgccgatgcattg
tttattcaaagaggtggaattcctagctgctccatcggtattcctaaccggtacatgcat
agccccgtggaggcctttcatttaaaagatttagaaacggcggctacttggattgctgcc
ttttgtaaagaaataaaaagcagggaagaaattctcccttctatagaaaaagaacctttt
ttagagaagcgtttttaa

DBGET integrated database retrieval system