KEGG   Methylacidiphilum infernorum: Minf_1835Help
Entry
Minf_1835         CDS       T00727                                 

Gene name
frvX
Definition
Cellulase M or related protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
min  Methylacidiphilum infernorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Minf_1835 (frvX)
Enzymes [BR:min01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Minf_1835 (frvX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1712861..1713958
Genome map
AA seq 365 aa AA seqDB search
MKKESFEFLLSLLNTPSPSSLETLGQKVWIDYVKNYAHRVEVDAYGNAVATLNLEGKPKI
LVNGHIDEIAFQVQYVDDNGFIYFSPVGGPDPKLSRGRKVNIFHEGKVVPGVIGTLAIHM
QEKEGQEKTPKWNELFIDIGASSRDEALEHVQVGDLVLYDSEAFCLLNDIWISRGCDDKV
GAFVAAEVLRICSEEKISAPCIVAASTIQEENGLYGASMIGYSIHPDIAIVVDVGHATDI
PIADKKKFGDIRLGKGPILSHGSVNHPGIVDYLNKLAHKLSLSHQHGIDPRRSGTDADAL
FIQRGGIPSCSIGIPNRYMHSPVEAFHLKDLETAATWIAAFCKEIKSREEILPSIEKEPF
LEKRF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagtcctttgaattccttttatctctcttgaatacccccagtccttcgagc
ctggaaaccttggggcaaaaagtatggattgattacgtaaaaaattatgcccaccgcgta
gaagtagatgcttatggcaacgccgtggcgactttaaacttggagggcaaacctaaaatt
cttgtcaatggccatatcgatgaaatcgctttccaagtccaatatgtcgatgacaacggt
tttatttatttttcccctgttggtggacctgatccaaaactttccaggggaagaaaagtg
aacattttccatgaaggcaaagttgttcccggtgtaattggtactcttgccatccatatg
caggagaaggaagggcaggaaaaaactccgaaatggaacgagctttttatcgatattgga
gcatcaagtagggatgaagcccttgaacatgtccaagttggagatctcgttctttacgat
agcgaggctttctgccttttaaacgatatctggatatcccgtggatgcgacgacaaggtt
ggggctttcgtcgccgcagaagttttgagaatctgctcggaagaaaaaatatccgctccc
tgtatcgttgccgcttccaccatccaggaggaaaatggactttacggagcgagcatgatc
ggatactccatccaccccgatattgccatcgtagtcgatgttggccatgcaaccgatatt
cccatagcggataagaaaaaattcggcgatattcgtcttgggaagggccccatcctcagt
catggtagtgtcaatcatcctggaatagtggactacctgaataaactcgcccacaagctt
tcccttagccatcagcatggcattgatcccaggcgatcgggaacagatgccgatgcattg
tttattcaaagaggtggaattcctagctgctccatcggtattcctaaccggtacatgcat
agccccgtggaggcctttcatttaaaagatttagaaacggcggctacttggattgctgcc
ttttgtaaagaaataaaaagcagggaagaaattctcccttctatagaaaaagaacctttt
ttagagaagcgtttttaa

DBGET integrated database retrieval system