KEGG   Methylacidiphilum infernorum: Minf_1850Help
Entry
Minf_1850         CDS       T00727                                 

Gene name
adhP
Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
min  Methylacidiphilum infernorum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Minf_1850 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Minf_1850 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    Minf_1850 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Minf_1850 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Minf_1850 (adhP)
   00626 Naphthalene degradation
    Minf_1850 (adhP)
Enzymes [BR:min01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Minf_1850 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1726065..1727333
Genome map
AA seq 422 aa AA seqDB search
MHGEQKTDIGMLSKALTPRSRSCRQPRGQGRWGTPAYGRHATFPRGDAPQGARNMARKGK
KMAPPGLPGEPNQRRPRFPPQPECWGLKRGKTMMKAMVLERPKNPLVLKDVPIPSPGPGE
VLLEVLVCGVCRTDLHVVDGELPNPKPNLIPGHEVVGIVRKLGSGATKFSIGQRVGVPWL
GKSCGQCRFCITGRENLCDRPEFTGYTRDGGYAEWIVADERFCFPIPPRYSNEEAAPLLC
AGLIGFRSYRHAEKSARIGFYGFGAAAHILIQIANHQGKAVFAFSKPGDRESQDFSLSLG
AAWAGDSTTLPPVLLDTAIIFAPVGALVPQALRAVEKGGTVVCAGIYMTDIPSFPYEILW
GERKIVSVANLTRDDGEEFFKIASQFKIQTRVEVLPLTEANNALQRLREGKVQGALALVP
KL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgcatggagagcaaaagaccgacattgggatgctttctaaagccctaacccctcgaagc
cggagttgcagacaaccgcgagggcaagggcgctggggtactccggcatacggcaggcat
gcaacattcccgaggggagacgcccctcaaggggcacgtaacatggcccgtaagggcaaa
aaaatggctcccccaggcctaccgggggagcccaaccaaaggaggccgcgctttcctccc
cagcctgaatgctggggtctcaaacgcggaaaaacgatgatgaaagctatggttcttgaa
agacccaaaaacccgctcgttttaaaggatgtccctatacccagtccgggtccgggtgaa
gttctcctggaggtactcgtatgcggcgtatgccgaacggatctccatgtcgtcgatgga
gaacttcctaatcccaagccgaatctcattcccgggcacgaagtggtgggaattgtaaga
aaattaggtagcggtgctaccaagttttcaattggtcaacgggtgggagttccttggcta
gggaaaagctgtggtcaatgtcggttttgtattacaggaagagaaaatctttgcgacagg
cccgaatttaccgggtatacacgggatggaggctatgcagaatggatagttgccgatgaa
cgcttttgttttcctattcctcctcgatactctaatgaagaggctgctcctcttttgtgc
gctggattgatcgggtttcgctcctacaggcatgcagaaaaatctgctcgcatcggtttc
tatggatttggagccgctgctcacattcttattcagatcgccaatcatcaagggaaagcc
gtttttgctttttccaagcctggagatagggaaagccaggatttttctctttcccttggt
gctgcgtgggccggggactccacgaccttacctcctgttcttttggacacggctatcatt
tttgcccccgtaggagccttggttcctcaagcccttcgtgccgtagaaaaaggagggaca
gttgtttgcgccgggatatacatgactgacatcccttctttcccttatgaaattttatgg
ggagaaagaaaaatcgtttccgtggccaatcttacaagagacgatggcgaagagtttttt
aaaattgcctcgcaattcaaaatccaaactcgagtggaagttttacctttaaccgaggcc
aataacgctcttcaaagactgagagaagggaaggtccaaggggctcttgccttggttcca
aaactataa

DBGET integrated database retrieval system