KEGG   Methylacidiphilum infernorum: Minf_1898Help
Entry
Minf_1898         CDS       T00727                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
min  Methylacidiphilum infernorum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:min00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1772656..1773519)
Genome map
AA seq 287 aa AA seqDB search
MLKKEMHWNLGKKMLRFPARRPMIMGVINLTPDSFSDGGKYMNPQAASDRALWMQDSGVD
FIDLGAESTRPGADPVDEKEEILRLLPVLKRCRAKLTVPLSVDTYKAAVSRVAIEEGADI
INDVSGGGWDPGILDVVAGGNVGYILVHSRGMPKNMQRDARYGDVVEEVFAELSNKLQRC
LNVGIAKERIVCDVGFGFAKDKTHNLKLLRRLDRFLDLGRPLMIGVSRKSFLQAFAKQHG
IDIEIMNTIAQTVAFFLGVEIWRVHDVSAAVAARNFLEKLWDTDLLQ
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaagaaatgcattggaatttgggaaaaaaaatgcttcgttttcctgcgcgt
cgtcccatgattatgggggtcattaacttaaccccagattctttttctgacgggggcaaa
tacatgaatccccaagcggcttcagaccgtgcactctggatgcaggacagcggggttgac
tttatcgatcttggagccgagtctacccgtcctggggccgatcctgttgacgaaaaagaa
gaaattttaagactcctccccgtcctgaaaagatgtagggctaaattgaccgtgccgttg
tccgtggatacttacaaggcggcagttagccgcgtagctatagaagaaggagccgatatc
attaatgatgtatccggagggggatgggatccaggtattcttgatgtcgttgcggggggc
aatgtcggctatatactcgtgcattctcgtgggatgcccaagaacatgcaaagggatgcc
cggtacggggacgtggtcgaagaagtttttgccgagctttcaaacaaactccaaaggtgt
ttaaatgtaggcatagccaaggaaagaatcgtttgtgatgtggggtttggatttgcaaaa
gataaaacgcataatctcaagttgctgcggaggttggatcgttttcttgatcttggaagg
ccactcatgatcggggtatcacggaaaagttttttgcaagcttttgccaaacaacatgga
atagatattgagataatgaataccattgctcaaacagttgcctttttcctcggagtggaa
atctggagagtgcatgatgtgtcggcggctgtggcggcaagaaattttcttgagaaactc
tgggatacggatcttttgcaatga

DBGET integrated database retrieval system