KEGG   Methylacidiphilum infernorum: Minf_1905Help
Entry
Minf_1905         CDS       T00727                                 

Gene name
mauG
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
min  Methylacidiphilum infernorum
Brite
Enzymes [BR:min01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Minf_1905 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1780370..1781569
Genome map
AA seq 399 aa AA seqDB search
MPFYSNRIKKIFYFHFLTVRSKDYKAFSSLYLKIFSSFLDEALKIFYKKKRLPMHKVSGF
FLCFICLPLLSFFSSNPGYSQEIAPDKVKTIFGIVPKVAENPSNPVTPEKVNLGRYLFFE
PRLSKSSKISCNSCHSLANSGVDGLPTSIGHKWQIGPRNAPTVLNAALEFTQFWDGRAKD
VEEQAMGPMLNPKEMASTKELVVQRLKSIPQYVEMFKKAFPDETDPVSFENAAKAIAAFE
RTLITPSRFDRYMDGDLSALSPEEKEGLKTFIQTGCISCHNGTGIGGGMFQKFGLVHKVS
WLQDLGRFEVTNNPADKYVFKVPSLRNVAKTAPYFNNGHTWSLEEAVKTMGYVQLGKNLT
DEEVKKIVSFLGSLSAEPPLQVTLPNLPPSTPQTPKPMP
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgccgttctattccaataggataaaaaaaatcttttactttcatttcttgacagttcga
tcaaaagattataaagccttcagtagtttgtatttaaaaatattttcatcctttctggat
gaagctttgaaaattttttacaaaaaaaagaggttaccgatgcacaaggtcagtgggttt
tttctctgttttatctgtttgccccttctttcctttttttcctcgaaccccggttattct
caagaaattgctcctgataaagtcaaaaccatcttcggcatcgtccccaaagttgcagaa
aatccttctaatcccgttactcctgagaaggtcaacttggggcgctatctcttttttgaa
cccaggctttcaaagagttctaaaatcagttgcaattcctgccatagcttggctaatagc
ggggttgatggcctgccgacttcaatcggtcataaatggcaaatcggtccaagaaatgct
cccacggtattgaatgcggccttggaattcacccaattttgggacggtcgagccaaggat
gtcgaagaacaagccatgggaccgatgctaaatcccaaggaaatggcctcgaccaaggaa
ctcgtggtccaaaggctgaaaagtatcccccaatacgtggaaatgttcaagaaagcattt
cctgatgaaaccgatccggtcagttttgagaacgcggcaaaagcgatagctgcctttgaa
cgcaccctcataaccccgtctcgttttgaccgatacatggacggagacctgtcggcgtta
agtcccgaagaaaaagaaggactgaagacttttatccagaccggttgtatttcctgccat
aatggaacgggtattggaggaggaatgttccaaaaattcggcttggtccacaaggttagc
tggttgcaggacctggggagattcgaggtcaccaacaacccggcggataaatatgttttc
aaagttccttctctacgcaacgtggctaaaaccgctccctatttcaacaatggtcatact
tggtctttagaagaggcggtaaaaacgatggggtatgtgcagcttggaaagaatttaacc
gatgaagaagtaaagaaaatcgtgagcttcctcggcagtctttctgcagaacctcccctg
caagttactctacccaatctccctccttcgacaccacaaaccccaaaaccaatgccttaa

DBGET integrated database retrieval system