KEGG   Methylacidiphilum infernorum: Minf_2029Help
Entry
Minf_2029         CDS       T00727                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
min  Methylacidiphilum infernorum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:min00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1887370..1887723)
Genome map
AA seq 117 aa AA seqDB search
MISALKNGTDVLLDIDVQGARQIRENKDPLLKNALVDVFIMPPTLEELERRLRKRGTETE
EELRLRLKTAREEMKLWPEFKYTILSGSMEEDLTKFRAIMRAERYLSRRLTLVEDPT
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtgatatccgcattaaagaatgggaccgatgtgcttttagacatcgatgttcaaggggcc
aggcagattagagaaaacaaagatccattgctaaagaatgccctggttgatgtctttatc
atgcccccgaccctcgaagaactggaaagaaggttgcgcaaaagggggacagaaaccgag
gaagaacttcggctgcggcttaagaccgccagggaagaaatgaagctttggcccgaattt
aaatataccatactcagtggttcaatggaggaggatttaacgaaatttcgggcgataatg
cgagccgagcgctacctgagccgaaggctcacgctcgtagaagaccccacttaa

DBGET integrated database retrieval system