KEGG   Methylacidiphilum infernorum: Minf_2030Help
Entry
Minf_2030         CDS       T00727                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
min  Methylacidiphilum infernorum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Minf_2030 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Minf_2030 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Minf_2030 (trpB)
Enzymes [BR:min01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Minf_2030 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1888078..1889316)
Genome map
AA seq 412 aa AA seqDB search
MQKTRFPFSLTLPDSLGYYGPYGGRFAPESLMEALLQLEAEYQKAKEDPRFKEELQELLK
NYAGRPTPLYHAKRLSSLLGDVKVYLKREDLLHTGAHKINNTLGQVLLAKRMGKKRVVAE
TGAGQHGVATATACALFGLECTIYMGEVDMERQALNVSRMKMLGARVCPVKVGQRTLKEA
INEGMRDWVTNLKTTHYVLGSALGPHPFPMIVRDFQKVIGEECREQFLAQEGKLPDVAIA
CVGGGSNAIGFFYGFLSDPQVRLVGVEAGGKGGSLGEHAARFASGKLGIFHGTKTFVLQD
EDGQIALTHSISAGLDYPAVGPEHAFLREKQRALYTKVSDEEALEGFFLLSRTEGILPAL
ESAHALAYCIKLGKELPKGAIVAVNLSGRGDKDVSQLSALHENNPVGREESL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaactcgattccctttctcgttaactcttcccgatagcttgggatattacggt
ccctatggaggacggtttgctccagagtcgctcatggaagctttgttgcagctcgaagcc
gagtatcaaaaggctaaggaagatccccggttcaaagaagaactccaagagctgcttaaa
aattacgccggaaggcctactccactctatcatgccaaaaggctttcttccctactcgga
gatgtcaaggtttatctcaagagggaagatctgctccataccggggcccataaaattaac
aatacgctgggccaggtgctcttggccaagcgcatgggcaagaaaagggtggtggccgag
acgggagcaggacagcatggagtggctacggcaacggcctgcgcgctctttggattggaa
tgcacgatctacatgggggaagtcgacatggaaagacaagctctcaacgtgagccggatg
aaaatgctgggggctcgagtatgccctgtgaaggtcggacagagaactttaaaagaagcc
atcaacgagggaatgagggattgggtgaccaacctcaaaaccacccattacgttcttgga
tcggccttaggaccgcatcccttcccgatgatcgtcagagattttcaaaaagtgatcggt
gaagaatgccgtgagcagtttctcgctcaagaagggaagctccctgacgtggccatagcc
tgtgtggggggagggagcaatgccataggatttttctatggatttctgtccgatccgcaa
gttcgcctcgtcggcgtagaagcgggtggcaagggaggaagtcttggagaacatgcggcg
cgttttgcttcgggcaaactagggatattccacggtaccaagacatttgttctccaggat
gaagatgggcagatcgctttgacccattccatttcagcgggactggattatccggcggtg
ggtcccgaacatgcctttttgagggaaaagcaaagggccctttataccaaggtttcagac
gaggaagccttggaaggattttttctcttatcgagaaccgaagggatattgccggccttg
gaaagcgctcatgccttggcttactgcataaaactcggcaaggagctcccgaagggagct
attgtggctgtaaacctttcagggaggggagataaggatgtgagccagctctctgccctg
cacgaaaacaaccctgtcggcagagaagagtccctgtag

DBGET integrated database retrieval system