KEGG   Methylacidiphilum infernorum: Minf_2278Help
Entry
Minf_2278         CDS       T00727                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
min  Methylacidiphilum infernorum
Pathway
min00260  Glycine, serine and threonine metabolism
min00400  Phenylalanine, tyrosine and tryptophan biosynthesis
min01100  Metabolic pathways
min01110  Biosynthesis of secondary metabolites
min01130  Biosynthesis of antibiotics
min01230  Biosynthesis of amino acids
Module
min_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Minf_2278 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Minf_2278 (trpA)
Enzymes [BR:min01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Minf_2278 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA NanE Spore_YtrH
Motif
Other DBs
NCBI-ProteinID: ACD84332
UniProt: B3E0A3
Position
complement(2118433..2119239)
Genome map
AA seq 268 aa AA seqDB search
MNSITKGRIAGTFSELSRNSQKAFIPFLMAGDPSPELFLDLVEALDESGADLLEVGIPFS
DPLADGPIIQQSAIRALKGGINMEEVFSLLSQIRQRSAIPVVLFSYLNPIFRYGIERFAQ
KAVESGADGVLIVDLPPEEVLEGVEVLEEKLDRVLLVTPSTSPERRRYIAGRSRGFLYCV
SRYGITGPQKEISKEAYELVKSVEPYKRVPLCVGFGVSTPEQARAISSYADGVVVGSALV
GEVARIAEGKSTVERFKDFAFSLAKSIH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtatcacgaagggaaggattgcaggaactttttcagagttgagccggaattcc
caaaaggccttcattccttttttgatggcgggagatccttctccagagcttttccttgat
cttgtggaagccttggatgaaagcggggcggacctgttggaagtgggcattcctttttct
gatcccttggccgatggtcccataatccaacaatcggctatccgggctttgaagggggga
ataaatatggaagaggttttttccttgctctctcagattcggcaaagatccgctatcccg
gttgtccttttttcttatcttaacccgatttttcgatacgggatcgagcggtttgcccag
aaagccgttgaaagtggggccgatggggtgctgatcgtcgatctcccccccgaggaagtc
cttgaaggggtggaggttttagaggaaaagcttgaccgggtattgcttgttactccttca
acttccccggaaaggagaaggtacatagcgggcagaagccggggctttctttactgtgtt
tcccgttacggcattaccggtccccaaaaggaaatatcaaaagaggcctatgaactggtc
aagtccgttgaaccctataaacgggtccccctttgtgtaggttttggggtatcgaccccg
gagcaggccagggccatttcttcttatgccgatggggttgtcgtgggtagtgccttggta
ggggaagtggcgaggatcgccgagggaaaaagcacggtggaaagattcaaagattttgct
ttttctcttgcaaaaagtattcattaa

DBGET integrated database retrieval system