KEGG   Methylacidiphilum infernorum: Minf_2304Help
Entry
Minf_2304         CDS       T00727                                 

Gene name
purL
Definition
phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
min  Methylacidiphilum infernorum
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Minf_2304 (purL)
Enzymes [BR:min01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     Minf_2304 (purL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2140912..2141634
Genome map
AA seq 240 aa AA seqDB search
MGKKRTMNWAIVEFPGSNCGPDCLYVVEKVLKHKATLLWHTDKRIPPVDALILPGGFSYG
DYLRSGAIASLSPIMEAVKEAAQAGVPILGICNGFQILCESRLLPGALITNRSLRFVCKR
VYLRVERTDSLFSHLFHPGEVIRIPIAHGQGCFYADPQTLEQMEAQGMILLRYCDCQGQV
GPQSNPNGSVGNIAAVQNQRGNVLGLMPHPERAAETEMGSVDGKKIFESLFRAVEAYKGK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaaagaacaatgaattgggcgatcgttgaatttcccggttctaattgtgga
ccggactgtctttatgtcgttgaaaaggtactcaagcataaggccaccttgctttggcac
accgacaagaggatcccccccgtcgatgcccttatcctgccgggggggttttcttacggg
gactacttgagatcgggagccatcgcctcgctatcgcccatcatggaagcggtcaaagag
gctgcccaggccggcgtgcccattctaggaatatgcaacggctttcaaatcctttgtgaa
tctaggctccttcccggggccttgatcactaaccgctccttgcggtttgtttgcaagcgg
gtttatctccgggtggaaagaacggattccctcttcagccacctttttcatcccggggag
gttatccgcatccccatcgctcatggacaaggctgtttttatgccgatccccagaccctt
gagcagatggaagcccaggggatgatcctcttgcgctactgcgattgccaaggccaagtt
ggcccccagtccaatcccaacggttcggtgggaaacatcgccgcggtacagaaccagcgg
gggaatgtcctagggttgatgccccatcccgaaagagctgcggagaccgaaatgggatcg
gtcgacgggaaaaaaatctttgaatccctttttcgagccgttgaagcttacaaaggaaaa
tga

DBGET integrated database retrieval system