KEGG   Mycobacterium intracellulare MOTT-64: OCQ_00990Help
Entry
OCQ_00990         CDS       T01755                                 

Definition
hypothetical protein
Orthology
K01273  
membrane dipeptidase [EC:3.4.13.19]
Organism
mir  Mycobacterium intracellulare MOTT-64
Brite
Enzymes [BR:mir01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.19  membrane dipeptidase
     OCQ_00990
Peptidases [BR:mir01002]
 Metallo Peptidases
  Family M19: membrane dipeptidase family
   OCQ_00990
Exosome [BR:mir04147]
 Exosomal proteins
  Proteins found in most exosomes
   OCQ_00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101074..102030
Genome map
AA seq 318 aa AA seqDB search
MTALLWDQHTCLPLATDADIEPLNRYQFAGGTVLSVNAGYSPHSFSDAVALLDHYRAAID
DHPGLELAATLGEVDAATQAGRIAVVFDLEDSRPLDDDLENLRRLANLGVRTLLPTYNNA
NRAGSGCLDRTDGGLTAWGRAIVAELNTVGIVPDGSHCSARTGLDMCEVSTGPVIYSHSC
MRALWDHPRNITDDQARACAQTGGVIGITGVGIFLGPNTPTLEAMTRHLEYAVDLVGIEH
VGISTDFCFDAADFANELRRNPHLFDASYTRWGPIQWVPPETFVTLGEHLRGRGWNGRDI
HAVLGGNFYRVAKQAWRA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccctgttgtgggaccagcacacgtgcctgccgctcgccaccgacgccgacatc
gaaccgttgaatcgttaccaattcgccggtggcacggtgctttcggtcaacgcgggatat
tcaccacacagcttcagcgacgccgtggcgctgctggatcactatcgtgccgcgatcgac
gaccaccccggcctggaattggcggccaccctcggtgaggtagacgcggcgacccaagcc
gggcgcatcgcggtcgtcttcgacctggaagattcacgcccgcttgacgacgacctggag
aatctgcggaggctggcgaacctgggagtgcgcaccctgttgccgacctataacaacgcc
aaccgcgcgggcagcggctgcctcgaccgcaccgacggcggcctcaccgcctggggccgt
gcgatcgtcgcggaactgaacacggtcggcatcgttcccgacgggtctcactgcagtgcg
cgcaccggtctcgacatgtgcgaggtatcgaccggcccggtcatttacagccactcatgc
atgcgcgcgttgtgggaccatccccgcaacatcaccgacgatcaggccagggcctgcgcg
cagacgggcggtgtcatcggcatcaccggcgtcggcatcttcctcggacccaacacgccc
acgctggaagcgatgacacggcacctcgaatacgccgtcgacctcgtcggcatcgagcac
gtcggtatcagcaccgacttctgtttcgacgccgccgatttcgccaacgagctgcgccgc
aatccccacctgttcgacgccagctacacccgctggggcccgatccagtgggtgccgccg
gaaacctttgtgacactcggtgagcacctgcggggaaggggatggaacggtcgtgacatc
cacgcggtcctcggtggcaacttctatcgggtggccaaacaagcctggcgcgcctga

DBGET integrated database retrieval system