KEGG   Mycobacterium intracellulare MOTT-64: OCQ_03610Help
Entry
OCQ_03610         CDS       T01755                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    OCQ_03610
Enzymes [BR:mir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     OCQ_03610
Exosome [BR:mir04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCQ_03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
368364..369890
Genome map
AA seq 508 aa AA seqDB search
MAEFAEFVAAIDQGTTSTRCMIFDHEGAEVARHQLEHEQILPQAGWVEHDPVEIWERTSS
VLTSVLNRANLAPKNIAALGITNQRETTLVWNRKTGRPYYNAIVWQDTRTDRIASALGAD
GRGEVIRRKAGLPPATYFSGAKLRWILENVDGVRDAAERGDALFGTPDTWVLWNLTGGPR
GGVHVTDVTNASRTMLMNLETLDWDDELLSFFAIPRAMLPRIGPSSSPQPYGVTAETGPA
GGEIAITGVLGDQHAAMVGQVCLAEGEAKNTYGTGNFLLLNTGETIVRSDNGLLTTVCYQ
FGDAKPVYALEGSIAVTGAAVQWLRDQLGIISGAAQSEALARQVDDNGGVYFVPAFSGLF
APYWRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMAADSGVRLEVLKVDGGI
TGNDLCMQIQADVLGVDVVRPVVAETTALGAAYAAGLAVGFWADPADLRANWQEGRRWSP
TWNDEQRAEGYAGWRKAVQRTLDWVSIT
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
ttggccgagttcgccgaattcgtggccgctatcgaccaggggacgaccagcacgcgctgc
atgatcttcgatcacgagggtgccgaggtggcccgccaccagctcgagcacgaacagatc
ctgccccaggcgggctgggtcgagcacgacccggtggagatctgggaacgtacctcctcg
gtgctgacctccgtgctcaaccgtgccaacctggcgccgaaaaacattgccgcgctgggt
atcacgaaccagcgcgagacgacgctggtctggaaccgcaagaccggacggccctattac
aacgcgatcgtctggcaggacacccgcaccgaccggatcgcgtcggcgctgggagccgac
ggccggggcgaggtgatccgccgcaaggcgggacttcccccggcgacgtacttctccggc
gcaaagctgcgatggatcttggagaatgtcgacggggtgcgcgacgccgccgagcgtggc
gacgcgttgttcggcaccccggacacctgggtgttgtggaacctgaccgggggtccgcgg
ggcggcgtgcacgtcaccgacgtgaccaacgccagccggaccatgctgatgaacctcgag
accctggactgggacgacgagttgctgtcattctttgcgatcccgcgcgcgatgctgccg
cggatcgggccgtcgtcgtcgccgcagccctacggggtgacggccgagaccggcccggcg
ggcggagagattgcgatcacgggcgtgctgggtgaccagcacgcggcgatggtggggcag
gtgtgtctggccgagggggaggcgaaaaacacctatggcaccggcaatttcctgctactg
aacaccggcgagacgatcgtgcggtccgacaacgggctgctgaccaccgtctgctaccag
ttcggggacgccaaacccgtttacgcacttgagggttcgatcgcggtgacgggcgcggcc
gtgcaatggctgcgcgatcagctgggcatcataagcggggccgcgcaaagcgaggcgctg
gcccgccaggtcgacgacaacggcggcgtctatttcgtcccggcgttttccgggttgttc
gccccctactggcgatccgatgcccggggcgcgatcgtggggctgtcccgattcaacacc
aacgcgcatctggcccgggccaccctggaggcgatctgctaccagagccgcgacgtggta
gacgcgatggccgcggattccggtgtgcgccttgaggttttgaaggtcgacggtggtatc
accggcaatgacctgtgcatgcagatccaggccgacgtgctgggcgtggacgtggtgcgt
ccggtggtcgccgagacgacggcgctgggcgccgcgtacgcggccggcctggccgtgggg
ttctgggccgacccggcggacctgcgcgccaactggcaggagggccggcgttggtcgccg
acctggaacgacgagcagcgcgccgaggggtacgcgggctggcgcaaggccgtgcagcgg
accctggattgggtctccatcacctga

DBGET integrated database retrieval system