KEGG   Mycobacterium paraintracellulare: OCQ_04080Help
Entry
OCQ_04080         CDS       T01755                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mir  Mycobacterium paraintracellulare
Pathway
mir00010  Glycolysis / Gluconeogenesis
mir00620  Pyruvate metabolism
mir00640  Propanoate metabolism
mir00680  Methane metabolism
mir01100  Metabolic pathways
mir01110  Biosynthesis of secondary metabolites
mir01120  Microbial metabolism in diverse environments
mir01130  Biosynthesis of antibiotics
mir01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCQ_04080
   00620 Pyruvate metabolism
    OCQ_04080
   00640 Propanoate metabolism
    OCQ_04080
  Energy metabolism
   00680 Methane metabolism
    OCQ_04080
Enzymes [BR:mir01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     OCQ_04080
Lipid biosynthesis proteins [BR:mir01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   OCQ_04080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFC51921
UniProt: A0A1X2KJC9
Position
complement(408255..410210)
Genome map
AA seq 651 aa AA seqDB search
MTATNSAGPSSYPPSARFAEQANAGEELYRDAERDRLAFWAEQANRLSWATPFTEVLDWS
DAPFAKWFGDGKLNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDHRSLTYSQLQTEVCKAA
NALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFAGFTAKALQARIADADAK
LLITSDGQFRRGKPAPLKDAADEAVSDPDSPIEHVVVVRRTGIDVSWNDDRDLWWHDVVD
AASPEHTPQPFDAEQPLFLLYTSGTTGKPKGIVHTSGGYLTHAAYTHHYVFDIKADSDVF
WCTADIGWVTGHTYGVYGPLANGVTEVLYEGTPDSPSQHRHFEIIEKYGVTIYYTAPTLI
RTFMKWGREIPDAHDLTSLRLLGSVGEPINPEAWRWYRKVIGADSLPIVDTWWQTETGAT
MISPLPGIAAAKPGSAMRPLPGVSAKIVDDHGEELPPPGEDKGEHVTGYLVLDQPWPSML
RGIWGDPQRYVETYWSRFAEQGWYFAGDSAYYDTEGDIWVVGRIDDVMNVSGHRLSTAEV
ESALVGHAAVAEAAVVGATDETTGQAICAFVVLCADFEVHDGIVDDLRVEVAREISPIAR
PREVHVVPELPKTRSGKIMRRLLRDIAENRELGDTSTLLDPGVFDAIRAAK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccaccaactctgcgggcccctcgtcgtatcccccgtcggcgcgattcgccgaa
caagccaatgcgggcgaggagctgtaccgcgacgccgagcgggaccggctggccttttgg
gccgagcaggccaaccggttgtcctgggcgacgccgttcaccgaggtgctggactggtct
gacgcgccgttcgccaaatggttcggcgacggcaagctcaacgtcgcatacaactgcgtg
gaccgccacgtggaggcgggccacggggatcgggtcgcaatccattgggagggcgagccc
gtcggtgaccaccgcagcctgacctactcgcagctgcaaaccgaggtctgcaaggccgcc
aacgcgctgaccgatctcggcctggtggccggtgaccgcgtcgccatctacctgccgctg
atcccggaggccgtgatcgcgatgctggcctgcgcgcgcctcggcatcatgcacagcgtg
gtgttcgccggcttcaccgccaaagcgctgcaggcccgcatcgccgacgccgatgccaag
ctgctgatcaccagcgacgggcagttccgccgcggcaagcccgcgcccctcaaggacgcc
gccgacgaggcggtctcggacccggacagccccatcgagcacgttgttgtggtgcggcgc
accggaattgacgtgtcctggaacgacgaccgcgatctgtggtggcacgacgtcgtcgac
gcagcctcccccgaacacaccccgcaaccgttcgacgccgaacaaccgttgttcctgctg
tacacctcgggaaccaccggcaagcccaagggcatcgtgcacaccagcggcggctacctg
acccacgccgcctacacgcaccactacgtcttcgacatcaaggccgacagcgacgtgttc
tggtgcaccgccgacatcggctgggtcaccggacacacctacggcgtctacggcccgctg
gccaacggcgtcaccgaggttctctacgaaggcacacccgacagcccgtcgcagcaccgg
catttcgagatcatcgaaaaatacggcgtgacaatctattacaccgcgcccacgctgatc
cgcacgttcatgaagtggggccgcgagattcccgacgcccacgacctgaccagcctgcgg
ctgctgggatcggtcggcgagccgatcaaccccgaagcatggcgctggtaccgcaaggtg
atcggcgccgacagccttccgatcgtcgacacctggtggcagaccgagaccggcgccacg
atgatctccccgttgcccggaatcgctgcggccaaaccgggttcggcgatgcggccgctg
ccgggtgtctcggcgaagatcgtcgacgaccacggcgaggagctgcccccaccgggcgag
gacaagggcgagcacgtcaccggctacctggtgctggaccagccgtggccgtcgatgctg
cgcggcatttggggcgatccgcaacgttatgtcgagacctactggtcccgattcgccgag
caaggctggtatttcgccggtgacagcgcctattacgacaccgagggcgacatctgggtg
gtcggccgcatcgacgacgtgatgaacgtgtcggggcatcggctctccacggccgaggtg
gagtcggcgctggtcggccacgccgcggtggccgaggcggcggtggtcggcgcgaccgac
gagacgacaggccaggccatctgcgcgttcgtcgtcttgtgcgcggatttcgaggtgcat
gacgggatcgtcgacgacctgcgcgtcgaggtggcccgggagatctcccccatcgcccgc
ccgcgcgaggtgcacgtggtgcccgagctacccaagacccgcagcggcaagatcatgcgc
aggctgttgcgggacatcgccgaaaaccgcgaattgggcgacacgtcaacgctgctcgat
cccggcgtgttcgacgcgatcagggcggcgaagtag

DBGET integrated database retrieval system