KEGG   Mycobacterium intracellulare MOTT-64: OCQ_04730Help
Entry
OCQ_04730         CDS       T01755                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mir00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OCQ_04730
Enzymes [BR:mir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     OCQ_04730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
469685..470287
Genome map
AA seq 200 aa AA seqDB search
MALPDTAMSKMRVFDQDRAEAAVRELLCAIGEDPDRHGLRETPARVARAYREMFAGLYTD
PDSVLNTMFDEDHDELVLVKEIPLYSTCEHHLVSFHGVAHVGYIPGNDGRVTGLSKIARL
VDLYAKRPQVQERLTSQIADALVKKLNPRGVIVVVEAEHLCMAMRGVRKPGATTTTSAVR
GIFKTNAASRAEALDLILRK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccggacaccgcgatgtccaagatgcgggtcttcgaccaggaccgtgccgag
gccgcggtccgcgagttgctgtgcgcgatcggcgaagacccggaccggcacgggctgcgg
gaaaccccggcccgcgtcgcccgcgcctaccgggagatgttcgccgggctctacaccgat
ccggacagcgtgttgaacaccatgttcgacgaggatcacgacgagttggtgctggtcaag
gaaatcccgctgtactccacgtgcgaacaccacctggtgtcgttccacggggtggcccac
gtcggctacatcccgggcaacgacggcagggtcaccggcctgtcgaagatcgcgcgactg
gtcgatctgtacgccaagcggccccaggtgcaggaacggctcaccagccaaatcgccgac
gcccttgtgaaaaagctcaatccgcgcggtgtgatcgtcgtggtcgaggccgagcacctg
tgcatggcgatgcgcggtgtccgcaagcccggagcgacgaccacgacctcggcggtgcgc
ggaatattcaaaacgaacgccgcttctcgagccgaggcgctcgacctcatcctgcggaag
tga

DBGET integrated database retrieval system