KEGG   Mycobacterium intracellulare MOTT-64: OCQ_04740Help
Entry
OCQ_04740         CDS       T01755                                 

Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mir  Mycobacterium intracellulare MOTT-64
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mir00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
470308..471135
Genome map
AA seq 275 aa AA seqDB search
MGVLNVTDDSFSDGGRYLDPDKAVAHGLALAADGADIVDVGGESTRPGATRVDARVEASR
VVPVVKELSSQGITVSIDTMHADVARAALCSGARIVNDVSGGRADPAMAPLLAEAKVPWV
LMHWRSVSAQRPHAAPDYRDVVAEVRAELLASVDAAVSAGVDPAQLMIDPGLGFAKTGQH
NWALLHALPRLVATGIPVLLGASRKRFLGTLLAGPDGSPRPPDGRETATAVISALAALHG
AWGVRVHDVRATVDALKVVAAWNDETHTGLAEHDG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggagttctgaacgtcactgacgattcgttctccgacggcggccgctatctcgacccc
gacaaagccgtggcacacggattggcgctggccgccgacggcgccgacatcgtcgacgtc
gggggagaatccacccgtcccggtgccacgcgcgtcgacgcccgtgtcgaggcctcccgg
gtcgtccccgtggtcaaagagctttcctcgcaaggcattacggtgagcatcgataccatg
cacgccgacgtcgcgcgggcggcgctgtgcagcggcgcgcggatcgtcaacgacgtgtcc
ggcggccgggccgatcccgccatggcgccgctgctggccgaggcgaaagtgccttgggtg
ctgatgcattggcgctccgtgtcggcgcagcgtccgcacgcggccccggactatcgtgac
gtggtcgccgaggtgcgcgccgagttgcttgccagtgtcgacgccgcggtgtccgccggt
gtcgatcccgctcagctgatgatcgatccggggctgggattcgccaagacgggacaacac
aattgggcgctgctgcatgcgctgccgcgattggtcgccaccgggatcccggtgctgctg
ggcgcgtcgcgcaaacggttcctcggtacgttgctggccgggcccgacggttcgccgcgg
ccccccgacgggcgtgagacggcgaccgcggtgatttccgcgctcgccgcgctgcacggg
gcctggggggtacgggtgcacgatgtgcgcgccacggtcgatgcgctcaaggtcgtggcg
gcgtggaacgacgagacgcacactgggctggctgaacacgatggctga

DBGET integrated database retrieval system